Key Takeaways
- •Its expression is typically absent in most normal tissues, which helps reduce the risk of off-target effects in immunotherapy.
- •NY-ESO-1 is considered among the most immunogenic cancer/testis antigens, eliciting spontaneous humoral (antibody) and cellular (T cell) responses in patients with NY-ESO-1-expressing tumors.
- •Its re-expression in tumors is thought to be governed by epigenetic mechanisms, such as CpG demethylation.
- •NY-ESO-1 is detected in a range of cancer types, including melanoma, lung, ovarian, esophageal, breast, bladder, and prostate cancers. In some tumor subtypes, NY-ESO-1 positivity correlates with higher infiltration of CD8+ T cells or stronger immune signatures.
- •NY-ESO-1 86-94 (HLA-A*02:01): RLLEFYLAM. The "gateway" epitope for A*02 populations.
NY-ESO-1: A Key Target in Peptide Clinical Trials for Cancer Immunotherapy
Cancer/Testis Antigen 1 (NY-ESO-1) stands as one of the most immunogenic proteins characterized to date. This small, 180-amino acid protein consists of a glycine-rich N-terminal region and a highly hydrophobic C-terminal region containing the Pcc-1 domain. Its high homology with another cancer/testis antigen, LAGE-1, and its aberrant expression in numerous malignancies (including melanoma, lung, and ovarian cancer) make NY-ESO-1 a primary target for TCR-T cell therapy, cancer vaccines, and immune monitoring in peptide clinical trials.
!Overview of NY-ESO-1 peptide epitopes
The Biology of Cancer/Testis Antigens
New York Esophageal Squamous Cell Carcinoma-1 (NY-ESO-1) belongs to the family of cancer/testis antigens, a subtype of Tumor-associated Antigens (TAAs). These antigens are normally expressed in germ cells of the testis and placental cells but can aberrantly be re-expressed in various tumors. Such re-expression lacks immune privilege and can trigger adaptive immune responses. Their strong immunogenicity and tumor-specific expression make cancer/testis antigens high-priority targets for cancer immunotherapy [1].
Key features of NY-ESO-1, also known as cancer-testis antigen 1B (CTAG1B), include:
- Its expression is typically absent in most normal tissues, which helps reduce the risk of off-target effects in immunotherapy.
- NY-ESO-1 is considered among the most immunogenic cancer/testis antigens, eliciting spontaneous humoral (antibody) and cellular (T cell) responses in patients with NY-ESO-1-expressing tumors.
- Its re-expression in tumors is thought to be governed by epigenetic mechanisms, such as CpG demethylation.
- NY-ESO-1 is detected in a range of cancer types, including melanoma, lung, ovarian, esophageal, breast, bladder, and prostate cancers. In some tumor subtypes, NY-ESO-1 positivity correlates with higher infiltration of CD8+ T cells or stronger immune signatures.
NY-ESO-1 Canonical Sequence and Peptide Pools for Clinical Research
The canonical sequence for NY-ESO-1 (UniProt: P78358-1) serves as the reference for peptide designs and epitope mappings:
```
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
```
Researchers working on peptide clinical trials often use full-sequence peptide pools covering the entire NY-ESO-1 sequence. A peptide pool spanning the full NY-ESO-1 sequence allows broad coverage of epitopes across diverse HLA molecules, triggering both CD4+ and CD8+ T cell responses. Synthetic peptides are easier to standardize, more stable, and allow for precise modifications compared to using entire proteins or viral vectors.
For high-precision immunology, sub-peptide pools focusing on immunodominant epitopes (covering residues 94-102, 127-136, 157-165, 157-165 mutant 165V, and 158-166) are ideal for validating TCR-T cell potency and characterizing specific CD8+ effector functions with maximum signal-to-noise ratio.
Key Epitope Clusters in NY-ESO-1 Peptide Clinical Trials
Research has identified specific regions within the NY-ESO-1 protein that exhibit exceptionally high immunogenicity. These immunodominant clusters are recognized by multiple HLA alleles, making them focal points for cross-reactive studies and vaccine design.
The 86-102 "Hotspot" Cluster
This region is a dense cluster of overlapping epitopes recognized by a wide array of HLA-A and HLA-B alleles. It is frequently used for epitope mapping and studying the hierarchy of T cell dominance.
- NY-ESO-1 86-94 (HLA-A02:01): RLLEFYLAM. The "gateway" epitope for A02 populations.
- NY-ESO-1_LAGE-2 91-101 (HLA-A*24:02): YLAMPFATPME. A long, high-affinity undecamer.
- NY-ESO-1 93-101 (HLA-B*07:02): AMPFATPME. A targeted nonamer for B-allele profiling.
- NY-ESO-1 94-102 (HLA-B*35:01): MPFATPMEA. A versatile epitope for multi-allele screening.
The 157-170 "Anchor" Cluster
Arguably the most famous region in cancer immunology, this cluster contains the primary anchor epitopes used in clinical trials worldwide.
- NY-ESO-1 157-165 (HLA-A02:01): SLLMWITQC. Wild-type. The global reference for A02:01 research.
- NY-ESO-1 157-165 mutant (HLA-A*02:01) 165V: SLLMWITQV. 165V Analog. An engineered heteroclitic variant for enhanced MHC-binding stability.
- NY-ESO-1 158-166 (HLA-A*24:02): LLMWITQCF. A critical epitope for Asian and Caucasian cohorts (shared with LAGE-1a).
- NY-ESO-1 162-170 (HLA-B*15:17): ITQCFLPVF. Expanding monitoring capabilities to specialized B-alleles.
Specialized Reference Epitopes
Beyond the main clusters, these two epitopes provide essential tools for broader HLA profiling and subdominant response analysis:
- NY-ESO-1 108-116 (HLA-A*02:01): SLAQDAPPL. Central reference epitope for analyzing subdominant T-cell responses.
- NY-ESO-1 127-136 (HLA-A*68:01): TVSGNILTIR. Specific decamer for extending immune monitoring to diverse HLA backgrounds.
Applications of NY-ESO-1 Peptides in Clinical Research
NY-ESO-1 peptides are used across several key research applications:
- Epitope Mapping and Discovery: Use overlapping peptide pools to screen which peptide fragments are recognized by patient or experimental T cells.
- Immune Monitoring: Track NY-ESO-1-specific T cell responses over time in patients or model systems.
- Cancer Vaccines and Immunotherapy Research: Use NY-ESO-1 peptides to elicit or boost anti-tumor T cell responses.
- T Cell Expansion (ex vivo): Stimulate and expand T cells specific to NY-ESO-1 epitopes for research or adoptive immunotherapy.
How to Validate Peptide Tools for Your Clinical Trial
For researchers planning a peptide clinical trial involving NY-ESO-1, validating the quality and specificity of peptide reagents is critical. At Volta Peptides, we provide resources to help you assess peptide purity, stability, and solubility before use. Use our Peptide Purity Analyzer to verify HPLC data, and our Stability Calculator to ensure proper storage conditions. Our Peptide Glossary offers definitions of key terms like epitope, HLA restriction, and immunodominance.
Conclusion
NY-ESO-1 remains a foundation of cancer immunotherapy research, with its well-characterized epitope clusters driving peptide clinical trials worldwide. By understanding the biology of this cancer/testis antigen and using validated peptide pools and single epitopes, researchers can design more effective immune monitoring, vaccine, and T cell therapy studies. For further reading, explore our BPC-157 Research Guide and TB-500 Research Guide for insights into other peptide targets in research.
Related Research Compounds
Looking for high-purity research peptides? Browse our catalog for HPLC-verified compounds.
| Compound | Purity | Size | Price |
|---|---|---|---|
| BPC-157 5mg | ≥98% | 5mg | $34.00 |
| TB-500 5mg | ≥98% | 5mg | $29.00 |
| BPC-157 10mg | ≥98% | 10mg | $44.00 |
Frequently Asked Questions
Q: What does peptide clinical trial mean in peptide research?
A: A peptide clinical trial is a research study that uses synthetic peptides (short chains of amino acids) to stimulate or modulate immune responses, typically in the context of cancer immunotherapy, vaccine development, or autoimmune disease. In the case of NY-ESO-1, these trials use specific peptide epitopes to activate T cells against tumors expressing the antigen.
Q: Which Volta resources help verify peptide clinical trial reagents?
A: Volta Peptides offers several tools to verify peptide quality and suitability for clinical trials: the Peptide Purity Analyzer checks HPLC purity, the Stability Calculator assesses storage conditions, and the Solubility Predictor helps determine appropriate solvents. Our Peptide Glossary also clarifies technical terms used in trial protocols.
Q: Why is NY-ESO-1 considered highly immunogenic?
A: NY-ESO-1 is among the most immunogenic cancer/testis antigens because it elicits spontaneous humoral (antibody) and cellular (T cell) responses in patients with NY-ESO-1-expressing tumors. Its expression is largely restricted to tumor cells and germ cells, reducing off-target effects, and it contains multiple immunodominant epitopes recognized by diverse HLA alleles.
Q: What are the main epitope clusters used in NY-ESO-1 peptide clinical trials?
A: The two main clusters are the 86-102 "Hotspot" cluster (recognized by HLA-A and HLA-B alleles) and the 157-170 "Anchor" cluster (containing the global reference epitope for A*02:01 research). These clusters are used for epitope mapping, immune monitoring, and vaccine design.
Q: How do researchers use peptide pools in NY-ESO-1 studies?
A: Researchers use full-sequence peptide pools (covering the entire 180-amino acid protein with overlapping peptides) to screen for T cell responses across multiple HLA types. Sub-pools focusing on immunodominant epitopes allow for high-specificity validation of TCR-T cell potency and characterization of CD8+ effector functions.