Ships from British Columbia, Canada|Canadian Orders Ship Domestically, No Border Crossing|International Shipping Available|Lab Verified|>99% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|Canadian Orders Ship Domestically, No Border Crossing|International Shipping Available|Lab Verified|>99% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|Canadian Orders Ship Domestically, No Border Crossing|International Shipping Available|Lab Verified|>99% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|Canadian Orders Ship Domestically, No Border Crossing|International Shipping Available|Lab Verified|>99% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|
effect collection

Immune Modulation Research Peptides

This collection highlights 21 peptides with documented immune modulation properties, organized by the strength of the supporting evidence. The selected peptides have been studied for their diverse mechanisms of action, ranging from direct antimicrobial effects to complex immunomodulatory roles. Research indicates that these peptides can play significant roles in therapeutic applications, particularly in the fields of infection control, autoimmune disorders, and tissue regeneration. Each peptide profile includes an overview of its mechanisms, evidence base, and potential research applications, offering valuable insights into their roles in modulating immune responses.

Overview

21 research peptides demonstrate immune modulation properties. This collection covers their mechanisms, evidence base, and research applications.

LL-37

LL-37 is the sole human cathelicidin antimicrobial peptide, comprising 37 amino acids (sequence: [LL-37, 37 aa]). Its broad-spectrum antimicrobial properties extend to Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms, positioning it as a crucial component of innate immunity. Research suggests that LL-37 not only facilitates pathogen clearance but also enhances wound healing and angiogenesis. Produced by epithelial and immune cells, its synthesis is stimulated by vitamin D. A randomized controlled trial has explored the efficacy of topical LL-37 in managing venous leg ulcers, highlighting its potential clinical applications. Mechanistically, LL-37's positive charge allows it to interact with negatively charged bacterial membranes, leading to cell lysis through pore formation. Additionally, its immunomodulatory functions encompass both pro-inflammatory and anti-inflammatory responses, including the recruitment of immune cells and activation of inflammasome signaling pathways. Overall, LL-37 represents a multifaceted peptide with promising therapeutic implications.

Epithalon

Epithalon, a synthetic tetrapeptide (Ala-Glu-Asp-Gly, MW ~390 g/mol), was developed by Russian gerontologist Vladimir Khavinson and has garnered attention for its potential anti-aging properties. Central to its function is the activation of telomerase, which plays a critical role in maintaining telomere length, thereby influencing cellular aging. While extensive research in Russia has reported its safety and efficacy, particularly in clinical settings, the lack of substantial Western clinical trials presents a limitation in its validation. Animal studies have indicated a lifespan extension of up to 13.3% in the last 10% of survivors, with statistical significance (p<0.05). Epithalon's mechanism involves not only telomerase activation but also enhancement of melatonin production, restoration of hormonal balance, and antioxidant defense. Its ability to penetrate the blood-brain barrier and its selective action on normal cells without activating telomerase in cancer cells add to its intrigue as a potential therapeutic agent in aging and related disorders.

Thymosin Alpha-1

Thymosin Alpha-1 (Ta1), a synthetic peptide also known as thymalfasin, is approved in over 35 countries for its immunomodulatory properties, particularly in the treatment of hepatitis B and C. This peptide distinguishes itself by modulating immune responses rather than merely enhancing them, a characteristic that has been validated in numerous clinical trials involving thousands of patients. The FDA has granted orphan drug designation to Ta1 for hepatitis B, underscoring its therapeutic potential. Recent studies, including one in 2024, have suggested its efficacy in restoring T-cell counts in HIV patients who are immunological non-responders. Mechanistically, Ta1 activates Toll-like receptors (TLR2 and TLR9), initiating signaling pathways that enhance immune system vigilance without triggering excessive inflammation. It plays a pivotal role in increasing MHC Class I expression, which aids in the detection of hidden viral and cancerous cells, while also promoting T-cell differentiation and function. Notably, Ta1 exhibits a unique ability to modulate immune responses based on the state of the immune system, providing a nuanced approach to immunotherapy.

Selank

Selank, a synthetic heptapeptide (Thr-Lys-Pro-Arg-Pro-Gly-Pro, MW ~751.89 g/mol), has been developed as a nootropic and anxiolytic agent at the Institute of Molecular Genetics in Russia. It is a structural analog of the immunomodulatory peptide tuftsin, modified to enhance stability. In Russia, Selank has received approval as a nasal spray for anxiety management, indicating its clinical relevance. Studies indicate that Selank effectively crosses the blood-brain barrier, where it enhances GABAergic neurotransmission and modulates monoamine systems, contributing to its anxiolytic effects. A pivotal study involving 62 patients with generalized anxiety disorder demonstrated that Selank provided comparable anxiety relief to medazepam, without the sedative effects or dependence risks associated with traditional anxiolytics. Its mechanism includes acting as a positive allosteric modulator of GABA-A receptors, increasing GABA binding affinity while protecting enkephalins from degradation. The peptide also exhibits immunomodulatory properties, suggesting a multifaceted role in both mental health and immune regulation.

Larazotide

Larazotide (AT-1001) is a synthetic 8-amino acid peptide designed to regulate tight junctions within the intestinal epithelium, making it a novel therapeutic candidate for celiac disease. As the first drug of its kind, larazotide has completed Phase II clinical trials and is currently undergoing Phase III trials (INN-202, also known as CeDLara). Its mechanism revolves around blocking the zonulin pathway, which is crucial for maintaining intestinal permeability. In celiac disease, gluten-derived gliadin peptides stimulate zonulin release, leading to increased permeability and subsequent immune responses. Larazotide acts locally in the gut, preventing the opening of tight junctions and thereby reducing paracellular permeability. It is noteworthy that larazotide is designed to remain in the intestinal lumen with minimal systemic absorption, as it is undetectable in plasma at therapeutic doses. While larazotide does not address the underlying autoimmune pathology of celiac disease, it represents a promising approach to mitigate the initial triggers of intestinal barrier dysfunction.

Thymulin

Thymulin (FTS) is a 9-amino-acid zinc metallopeptide (sequence: pyroGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn, MW ~858 g/mol) secreted exclusively by thymic epithelial cells. Its biological activity hinges on zinc binding, which is essential for T-cell differentiation and maturation. Research indicates that thymulin levels decline with age and thymic involution, suggesting its potential role in age-related immunodeficiency. Studies have investigated thymulin as an immunomodulator, particularly in contexts of immunodeficiency and aging.

Mechanistically, thymulin binds zinc in a 1:1 ratio, stabilizing its active conformation for receptor engagement. This interaction promotes T-cell differentiation and modulates cytokine production, enhancing T-cell-mediated immune responses. Thymulin activates intracellular signaling pathways, including protein kinase C, and influences the hypothalamic-pituitary-adrenal axis. Furthermore, it has been shown to downregulate pro-inflammatory cytokines (e.g., TNF-alpha, IL-1beta, IL-6) while promoting the anti-inflammatory cytokine IL-10. In central nervous system models, thymulin exhibits analgesic and anti-inflammatory properties, potentially through modulation of NF-kappaB signaling.

Octreotide

Octreotide is a synthetic 8-amino-acid cyclic peptide (MW ~1019.2 g/mol) that mimics the actions of natural somatostatin, characterized by a significantly extended half-life. It is FDA-approved for various conditions, including acromegaly and certain neuroendocrine tumors. Its therapeutic applications stem from its ability to modulate hormonal secretion and exert antiproliferative effects.

The mechanism of action for octreotide involves its preferential binding to somatostatin receptor subtypes 2 (SSTR2) and 5 (SSTR5), with a moderate affinity for SSTR3. This binding inhibits the secretion of growth hormone, glucagon, and insulin, while also reducing splanchnic blood flow and various gastrointestinal hormones. In neuroendocrine tumors, octreotide has demonstrated antiproliferative effects through mechanisms such as cell cycle arrest via SSTR2-mediated pathways and inhibition of angiogenesis. The immediate-release formulation has a half-life of 1.5-2 hours, while the sustained-release formulation, Sandostatin LAR, allows for drug release over four weeks through biodegradable microspheres.

Selank 10mg + Semax 10mg (20mg)
Out of Stock

Selank 10mg + Semax 10mg (20mg)

20mg

$82 USD
Notify me
Epithalon 50mg
Out of Stock

Epithalon 50mg

50mg

$72 USD
Notify me
Selank 10mg
Out of Stock

Selank 10mg

10mg

$32 USD
Notify me

Lanreotide

Lanreotide is an FDA-approved synthetic somatostatin analog that exhibits a unique self-assembly property, forming nanotubes at high concentrations, which enables sustained release over four weeks from a single injection. This peptide is primarily utilized in the management of acromegaly and neuroendocrine tumors.

The mechanism of action for lanreotide is similar to that of octreotide, as it binds with high affinity to somatostatin receptor subtypes SSTR2 and SSTR5, and with moderate affinity to SSTR3. It effectively inhibits the secretion of growth hormone, thyroid-stimulating hormone, and various gastrointestinal hormones. The antiproliferative effects of lanreotide are mediated by SSTR2-induced cell cycle arrest, reduced expression of vascular endothelial growth factor (VEGF), and the induction of apoptosis in somatostatin receptor-expressing tumor cells. The Autogel formulation allows for a bioavailability of 73-90%, with peak plasma concentrations reached 7-12 hours post-injection, providing a therapeutic advantage in chronic conditions.

Romiplostim

Romiplostim is an FDA-approved peptide-Fc fusion protein (peptibody) with a molecular weight of approximately 59,000 g/mol, functioning as a thrombopoietin (TPO) receptor agonist. It is indicated for the treatment of chronic immune thrombocytopenic purpura (ITP).

The mechanism of action involves the binding of romiplostim to the TPO receptor (c-Mpl) on megakaryocytes, stimulating platelet production. This peptibody consists of two identical single-chain subunits, each featuring a human IgG1 Fc domain linked to a peptide sequence with two TPO receptor-binding domains. The sequences were identified through phage display and lack homology to endogenous TPO, minimizing the risk of anti-TPO antibody formation. Activation of the TPO receptor triggers multiple signaling cascades, including JAK2/STAT5, MAPK, and PI3K/AKT, leading to increased megakaryocyte proliferation and maturation. The half-life of romiplostim varies from 1 to 34 days, with a median of 3.5 days, and it is produced using recombinant DNA technology in E. coli.

Glutathione

Glutathione, a tripeptide (Glu-Cys-Gly, MW ~307.3 g/mol), is recognized as the most abundant intracellular antioxidant in mammalian cells, playing a pivotal role in Phase II detoxification, free radical scavenging, immune function, and maintaining cellular redox homeostasis. Given its poor oral bioavailability (~3%), injectable forms (SC/IV) have been developed to achieve clinically meaningful plasma concentrations, with studies exploring its efficacy in conditions like non-alcoholic fatty liver disease and Parkinson's disease.

The primary mechanism of glutathione involves its function as a reducing agent, directly scavenging reactive oxygen species (ROS) and serving as a cofactor for critical enzymes such as glutathione peroxidase and glutathione-S-transferase. In its reduced form (GSH), it neutralizes free radicals and peroxides, converting to oxidized glutathione (GSSG). This conversion is facilitated by glutathione reductase using NADPH. Furthermore, glutathione conjugates with xenobiotics and toxins for excretion via Phase II metabolism. Its half-life after subcutaneous injection ranges from 1 to 2 hours, and it has been shown to support T-cell proliferation, enhance natural killer (NK) cell activity, and modulate cytokine production.

PNC-27

PNC-27 is a chimeric peptide with a molecular weight of approximately 3,000 g/mol, designed for cancer research. It consists of a p53 protein binding domain fused to a cell-penetrating/membrane-lytic domain, aimed at selectively targeting HDM-2 (human homolog of MDM-2) expressed on the surface of cancer cells. This peptide has shown promise in vitro for selectively inducing necrosis in malignant cells while sparing normal cells, although it has no established human clinical trials. The FDA has cautioned that PNC-27 products are unapproved drugs being marketed illegally.

The mechanism of action for PNC-27 involves its 12-residue p53 peptide sequence, which binds to membrane-bound HDM-2, leading to the formation of pores in the cancer cell membrane and subsequent necrosis. Studies in vitro have demonstrated its selectivity for various cancer cell lines, including breast, pancreatic, leukemia, and melanoma, while showing limited effects on non-transformed cells. However, the absence of clinical data in humans and regulatory warnings highlight significant limitations in its therapeutic applicability.

Thymalin

Thymalin is a polypeptide complex extracted from calf thymus glands, originally developed by Vladimir Khavinson and his team at the St. Petersburg Institute of Bioregulation and Gerontology. A pivotal study conducted by Khavinson et al. (2003) revealed that a combination treatment of thymalin and epithalamin led to a remarkable 4.1-fold reduction in mortality among elderly patients compared to control groups. The underlying hypothesis is that thymalin may restore thymic function and bolster T-cell immunity, which typically diminishes with advancing age.

Mechanism: Thymalin consists of short bioregulatory peptides, primarily di- and tripeptides, including Glu-Trp, derived from thymic tissue. These peptides are theorized to interact with DNA regulatory sequences, thereby modulating gene expression pertinent to immune function. Specifically, thymalin is believed to enhance thymopoiesis, promote T-cell differentiation and maturation, restore CD4/CD8 ratios, increase natural killer (NK) cell activity, and influence cytokine production. The bioregulation theory posits that short peptides can bind to specific DNA sequences, affecting transcriptional regulation in aging tissues.

Vilon

Vilon (Lys-Glu, KE) is a synthetic dipeptide developed by Khavinson as a streamlined version of the active component found in thymalin. With a molecular weight of approximately 275.3 g/mol, it is among the shortest bioregulatory peptides proposed for immunomodulatory effects. Research predominantly published in Russian literature suggests that Vilon may have the potential to influence immune function, although its validation in Western studies remains limited.

Mechanism: Vilon is theorized to interact with specific DNA sequences within gene promoter regions that regulate immune-related genes, thereby modulating their transcription. Evidence indicates that Vilon may enhance T-cell proliferation and differentiation, counteract age-related declines in thymic output, and adjust cytokine profiles to favor immune competence. Furthermore, it is suggested to have epigenetic effects, potentially influencing DNA methylation patterns at immune regulatory loci.

Livagen

Livagen (Lys-Glu-Asp-Ala, KEDA) is a synthetic tetrapeptide, with a molecular weight of approximately 432.5 g/mol, that was developed by Khavinson as a liver-specific bioregulatory peptide. This compound is posited to target heterochromatin in hepatocytes, aiming to reactivate genes that become silenced during aging and thereby restore liver function. While the majority of published studies are found in Russian journals, the findings suggest potential benefits for hepatic health in aged populations.

Mechanism: Livagen is proposed to penetrate the nuclei of hepatocytes, where it interacts with specific regions of condensed heterochromatin that are silenced with age. By binding to complementary DNA sequences in liver-specific gene promoters, Livagen is claimed to decondense chromatin, thereby reactivating gene transcription and enhancing hepatic protein synthesis. Electron microscopy studies by Khavinson et al. have shown that Livagen treatment can reduce heterochromatin density in aged rat hepatocyte nuclei, with implications for detoxification enzyme expression and hepatocyte regeneration.

Vesilute

Vesilute (Lys-Glu-Asp, KED) is a synthetic tripeptide, with a molecular weight of approximately 390.4 g/mol, developed as a vascular-specific bioregulator within the Khavinson bioregulatory peptide family. The peptide is proposed to improve endothelial function, mitigate atherosclerotic changes, and enhance vascular elasticity, addressing issues associated with aging. Most evidence supporting Vesilute's effects is found in Russian literature, indicating a need for broader validation in the global research community.

Mechanism: Vesilute is believed to modulate gene expression in vascular endothelial and smooth muscle cells. It may restore the production of nitric oxide synthase, elastin, and other critical structural proteins that typically decline with vascular aging. By potentially reducing endothelial dysfunction, improving vascular compliance, and lowering inflammatory markers within blood vessel walls, Vesilute represents a promising area of research for cardiovascular health in aging populations.

Shop Research Peptides

Selank 10mg + Semax 10mg (20mg)
Out of Stock

Selank 10mg + Semax 10mg (20mg)

20mg

$82 USD
Notify me
Epithalon 50mg
Out of Stock

Epithalon 50mg

50mg

$72 USD
Notify me
Selank 10mg
Out of Stock

Selank 10mg

10mg

$32 USD
Notify me
Thymalin 10mg
Out of Stock

Thymalin 10mg

10mg

$39 USD
Notify me
LL-37 5mg
Out of Stock

LL-37 5mg

5mg

$47 USD
Notify me
Glutathione 1500mg
Out of Stock

Glutathione 1500mg

1,500mg

$43 USD
Notify me
Thymosin Alpha-1 10mg
Out of Stock

Thymosin Alpha-1 10mg

10mg

$64 USD
Notify me
BPC-157 5mg
In Stock

BPC-157 5mg

5mg

$25 USD
Retatrutide 20mg
In Stock

Retatrutide 20mg

20mg

$79 USD

Quality Documentation

Review batch documentation before making research purchasing decisions. Volta pairs product education with COA literacy so researchers can evaluate purity, identity, lot details, and testing context.

Product cards on this page link to current catalog entries and available quality documentation.

Follow Research Updates

Get new research pages, product updates, tool releases, and quality resources from Volta.

Subscribe

Frequently Asked Questions

Related Research

Research Use Only. The information on this page is compiled from published research literature and is provided for educational purposes only. It does not constitute medical advice. All compounds referenced are intended for in vitro research use by qualified laboratories and institutions.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.