Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Research Use Only|International Shipping|North American Made|Free Shipping $149 USD+|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Research Use Only|International Shipping|North American Made|Free Shipping $149 USD+|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Research Use Only|International Shipping|North American Made|Free Shipping $149 USD+|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Research Use Only|International Shipping|North American Made|Free Shipping $149 USD+|
effect collection

Immune Modulation Research Peptides

21 peptides with demonstrated immune modulation effects in research. Sorted by evidence quality from strongest to exploratory.

Overview

21 research peptides demonstrate immune modulation properties. This collection covers their mechanisms, evidence base, and research applications.

LL-37

Preclinical | Antimicrobial / Immune

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi,...

Mechanism: LL-37 (C120H232N42O38) carries a net positive charge (+6) that binds negatively charged bacterial membranes, creating transmembrane pores causing cell lysis. It also has anti-biofilm activity.

Epithalon

Preclinical | Anti-Aging / Telomere

Epithalon is a synthetic tetrapeptide (Ala-Glu-Asp-Gly, MW ~390 g/mol) developed by Russian gerontologist Vladimir Khavinson at the St. Petersburg Institute of Bioregulation and Gerontology.

Mechanism: Epithalon (C14H22N4O9, MW ~390 daltons) activates telomerase, particularly the catalytic subunit TERT (telomerase reverse transcriptase), extending telomeres at chromosome ends.

Thymosin Alpha-1

Phase I–II Clinical Trials | Immune Modulator

Thymosin alpha-1 (Ta1) is a clinically proven, 28-amino-acid peptide (MW ~3,108 g/mol, Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH) naturally produced by the thymus gland.

Mechanism: Ta1 (C129H215N33O55) activates Toll-like Receptors TLR2 and TLR9 on immune cells, triggering the MyD88 and NF-kB signaling pathways to put the immune system on alert without destructive inflammation.

Selank

Preclinical | Nootropic / Anxiolytic

Selank is a synthetic heptapeptide (Thr-Lys-Pro-Arg-Pro-Gly-Pro, MW ~751.89 g/mol) developed at the Institute of Molecular Genetics of the Russian Academy of Sciences.

Mechanism: Selank (C33H57N11O9, half-life ~2-10 minutes) crosses the blood-brain barrier. It acts as a positive allosteric modulator of GABA-A receptors, increasing GABA binding affinity without directly...

Larazotide

Phase III / NDA Filed | Healing & Recovery

Larazotide (AT-1001) is a synthetic 8-amino acid peptide that acts as a tight junction regulator. It is being developed as an oral adjunct therapy for celiac disease, designed to reduce intestinal permeability ("leaky gut") triggered by gluten...

Mechanism: Larazotide acts as a zonulin antagonist, blocking the zonulin pathway that opens tight junctions in the intestinal epithelium.

Thymulin

Early Clinical / Preclinical | Immune Modulator

Thymulin (FTS) is a 9-amino-acid zinc metallopeptide (sequence: pyroGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn, MW ~858 g/mol) secreted exclusively by thymic epithelial cells.

Mechanism: Thymulin binds zinc in a 1:1 stoichiometric ratio, which is required for its active conformation and receptor binding.

Octreotide

FDA Approved | Endocrine / Somatostatin Analog

Octreotide is a synthetic 8-amino-acid cyclic peptide (MW ~1019.2 g/mol) that mimics the pharmacological actions of natural somatostatin but with a significantly longer half-life.

Mechanism: Octreotide binds preferentially to somatostatin receptor subtypes 2 (SSTR2) and 5 (SSTR5), with moderate affinity for SSTR3.

Lanreotide

FDA Approved | Endocrine / Somatostatin Analog

Lanreotide is a synthetic 8-amino-acid cyclic somatostatin analog (MW ~1096.3 g/mol) available as a long-acting deep subcutaneous depot injection (Somatuline Depot/Autogel).

Mechanism: Lanreotide binds with high affinity to somatostatin receptor subtypes SSTR2 and SSTR5, and with moderate affinity to SSTR3.

Romiplostim

FDA Approved | Hematology / TPO Agonist

Romiplostim is a peptide-Fc fusion protein (peptibody) with a molecular weight of approximately 59,000 g/mol that acts as a thrombopoietin (TPO) receptor agonist.

Mechanism: Romiplostim is a "peptibody" consisting of two identical single-chain subunits, each containing a human IgG1 Fc domain covalently linked to a peptide chain containing two TPO receptor-binding domains.

Glutathione

Meaningful Human Clinical Data | Antioxidant / Detoxification

Glutathione is a tripeptide (Glu-Cys-Gly, MW ~307.3 g/mol) and the most abundant intracellular antioxidant in mammalian cells. It is critical for Phase II detoxification, free radical scavenging, immune function, and cellular redox homeostasis.

Mechanism: Glutathione functions as the primary intracellular reducing agent, directly scavenging reactive oxygen species (ROS) and serving as a cofactor for glutathione peroxidase and glutathione-S-transferase...

PNC-27

Animal/Preclinical Only | Cancer Research

PNC-27 is a chimeric peptide (~3,000 g/mol) composed of a p53 protein binding domain fused to a cell-penetrating/membrane-lytic domain.

Mechanism: PNC-27 contains a 12-residue p53 peptide sequence that binds to HDM-2 (MDM-2 in humans), a protein normally found in the nucleus but abnormally expressed on the outer cell membrane of many cancer...

Thymalin

Early Human or Mixed Evidence | Immune / Anti-Aging

Thymalin is a polypeptide complex isolated from calf thymus glands, developed by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology.

Mechanism: Thymalin contains short bioregulatory peptides (primarily di- and tripeptides including Glu-Trp) derived from thymic tissue.

Vilon

Animal/Preclinical Only | Immune / Anti-Aging

Vilon (Lys-Glu, KE) is a synthetic dipeptide (MW ~275.3 g/mol) developed by Khavinson as a simplified synthetic version of the active component in thymalin. It is one of the shortest bioregulatory peptides proposed to have immunomodulatory activity.

Mechanism: Vilon (Lys-Glu) is proposed to complement DNA sequences in gene promoter regions controlling immune-related genes, modulating their transcription.

Livagen

Animal/Preclinical Only | Hepatic / Anti-Aging

Livagen (Lys-Glu-Asp-Ala, KEDA) is a synthetic tetrapeptide (MW ~432.5 g/mol) developed by Khavinson as a liver-specific bioregulatory peptide.

Mechanism: Livagen is proposed to penetrate hepatocyte nuclei and interact with specific heterochromatin regions that become condensed (silenced) during aging.

Vesilute

Animal/Preclinical Only | Cardiovascular / Anti-Aging

Vesilute (Lys-Glu-Asp, KED) is a synthetic tripeptide (MW ~390.4 g/mol) from the Khavinson bioregulatory peptide family, developed as a vascular-specific bioregulator.

Mechanism: Vesilute is proposed to modulate gene expression in vascular endothelial and smooth muscle cells, restoring production of nitric oxide synthase, elastin, and other structural/functional proteins that...

Related Research News

Peptide Tools

Frequently Asked Questions

Explore More

Research Use Only. The information on this page is compiled from published research literature and is provided for educational purposes only. It does not constitute medical advice. All compounds referenced are intended for in vitro research use by qualified laboratories and institutions.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.