Peptides for Immune Support

12 research peptides are currently studied for immune support. This guide ranks them by evidence strength and covers their mechanisms, safety profiles, and current clinical status.

Evidence Rating: C

Category: Immune Modulator

Thymosin alpha-1 (Ta1) is a clinically proven, 28-amino-acid peptide (MW ~3,108 g/mol, Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH) naturally produced by the thymus gland. A synthetic version (thymalfasin, marketed as Zadaxin) is approved in over 35 countries for treating hepatitis B and C and as an immune adjuvant. It modulates rather than simply boosts immunity, making it unique among immune therapies. Clinical trials involving thousands of patients show robust safety data, with an FDA orphan drug designation for hepatitis B in the US. A 2024 study showed potential in restoring T-cell counts in immunological non-responder HIV patients.

Key claims: Treats hepatitis B with sustained response; Enhances immune function and T-cell activity.

Evidence Rating: C

Category: Immune Modulator

Thymulin (FTS) is a 9-amino-acid zinc metallopeptide (sequence: pyroGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn, MW ~858 g/mol) secreted exclusively by thymic epithelial cells. It requires zinc binding for biological activity and plays a central role in T-cell differentiation and maturation. Thymulin serum levels decline with age and thymic involution, and it has been investigated as an immunomodulator in immunodeficiency states and aging.

Key claims: Restores T-cell function in aging and immunodeficiency; Anti-inflammatory effects in animal models.

Evidence Rating: C

Category: Immune / Anti-Aging

Thymalin is a polypeptide complex isolated from calf thymus glands, developed by Vladimir Khavinson and colleagues at the St. Petersburg Institute of Bioregulation and Gerontology. It has been used clinically in Russia since the 1980s for immunodeficiency states and as an anti-aging intervention. A landmark 6-year study by Khavinson et al. (2003) showed thymalin + epithalamin treatment reduced mortality by 4.1x in elderly patients compared to controls. Thymalin is proposed to restore thymic function and T-cell immunity that declines with age.

Key claims: Reduces mortality in elderly patients; Restores immune function in immunodeficiency.

Evidence Rating: D

Category: Antimicrobial / Immune

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 has immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial cells and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial has evaluated topical LL-37 in venous leg ulcers.

Key claims: Broad-spectrum antimicrobial activity; Promotes wound healing.

Evidence Rating: D

Category: Anti-Inflammatory / Immune

KPV is a naturally occurring tripeptide (Lys-Pro-Val, MW ~342.4 g/mol) derived from the C-terminal region (positions 11–13) of alpha-melanocyte-stimulating hormone (α-MSH). It retains potent anti-inflammatory and antimicrobial properties of the full-length hormone without activating melanocortin receptors responsible for skin pigmentation or sexual arousal. KPV suppresses NF-κB activation and is transported into intestinal epithelial cells via the PepT1 transporter, which is upregulated during gut inflammation — creating a self-targeting mechanism. Its small size enables oral bioavailability, which is unusual for peptides. It was among the 12 peptides removed from FDA Category 2 on April 15, 2026.

Key claims: Reduces intestinal inflammation; Anti-inflammatory without pigmentation.

Evidence Rating: D

Category: Antimicrobial / Immune

Beta-defensins are a family of small cationic antimicrobial peptides (36-45 amino acids, MW ~4-5 kDa) produced by epithelial cells throughout the body. The three best-characterized human beta-defensins are HBD-1 (constitutive), HBD-2 (inducible by infection/inflammation), and HBD-3 (broad-spectrum, including anti-MRSA activity). They are key components of innate mucosal immunity and serve as endogenous reference molecules rather than therapeutic products.

Key claims: Broad-spectrum antimicrobial activity; Link innate and adaptive immunity.

Evidence Rating: D

Category: Antimicrobial / Immune

Alpha-defensins are a family of small cationic antimicrobial peptides (29-35 amino acids, MW ~3.5-4.5 kDa) with three characteristic intramolecular disulfide bonds. Human neutrophil peptides (HNP-1 through HNP-4) are stored in azurophilic granules and released during neutrophil degranulation, while human defensins HD-5 and HD-6 are produced by Paneth cells in the small intestinal crypts. They are major effectors of innate immunity and endogenous reference molecules.

Key claims: Critical components of neutrophil antimicrobial defense; HD-6 forms nanonets to trap bacteria.

Evidence Rating: D

Category: Antimicrobial / Immune

Lactoferricin is a 25-amino-acid antimicrobial peptide (f17-41 of bovine lactoferrin; MW ~3126 g/mol for bovine form) generated by pepsin digestion of lactoferrin. Bovine lactoferricin (LfcinB) is substantially more antimicrobially active than the parent protein and exhibits broad-spectrum activity against bacteria, fungi, viruses, and parasites. It also demonstrates anticancer properties in preclinical models. It remains a preclinical research molecule with no approved therapeutic applications.

Key claims: Broad-spectrum antimicrobial activity; Anticancer activity in preclinical models.

Evidence Rating: D

Category: Immune / Anti-Aging

Vilon (Lys-Glu, KE) is a synthetic dipeptide (MW ~275.3 g/mol) developed by Khavinson as a simplified synthetic version of the active component in thymalin. It is one of the shortest bioregulatory peptides proposed to have immunomodulatory activity. According to Khavinson bioregulation theory, this dipeptide interacts with specific DNA sequences to modulate gene expression related to immune function and thymopoiesis. Published primarily in Russian literature with limited Western validation.

Key claims: Restores immune function in aging; Modulates gene expression via DNA binding.

Evidence Rating: D

Category: Immune / Bioregulator

Thymagen (Glutamyl-Tryptophan) is a synthetic dipeptide from the Khavinson bioregulator series registered in Russia for immunodeficiency conditions. It modulates T-cell differentiation and immune function.

Key claims: Immune system normalization; Evidence is confined to the Khavinson bioregulator programme.

Evidence Rating: D

Category: Immune Modulator / Bioregulator

Thymogen is a synthetic dipeptide (L-glutamyl-L-tryptophan) developed in Russia as an immune modulator. It has been used clinically in Russia since the 1980s for immune deficiency states, post-surgical recovery, and as an adjunct in infectious disease treatment. While widely prescribed in Russian medicine, it has minimal recognition in Western medical literature and no peer-reviewed English-language clinical trials meeting modern standards. Its mechanism is attributed to thymic function enhancement.

Key claims: Enhances immune function in immunocompromised patients; Reduces infection rates post-surgery.

Evidence Rating: F

Category: Bioregulator / Immune

Kristagen is a Russian bioregulator peptide complex marketed for immune system support, derived from young animal thymus tissue extracts. Developed by the Khavinson group, it is promoted as a successor to Thymalin (a thymic extract used in Russian medicine since the 1970s). Like other Khavinson bioregulators, it lacks peer-reviewed clinical evidence meeting international standards. The concept of organ-specific peptide bioregulation remains unvalidated by Western medical science.

Key claims: Restores immune function in elderly patients; Extends lifespan.