Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|
LL-37 5mg specification card: catalogue number, CAS number, molecular formula and purity

LL-37 5mg Peptide

For in-vitro laboratory research only. Not for human or animal administration.

Batch #: VPLL5100

$57 USD

Get Notified When Available

This product is currently out of stock. Enter your email and we'll notify you the moment it's back.

Application formLyophilized powder
StorageRefrigerated
Purity>99%
Weight5mg
CAS Number154947-66-7
Molecular FormulaC₂₀₅H₃₄₀N₆₀O₅₃

Research Use Only

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Batch-specific Certificates of Analysis available for all products.

LL-37 5mg: overview

What the vial contains and what the material is, stated as specifications rather than as outcomes.

LL-37 supplied as a lyophilized powder in a sealed single-use vial containing 5 mg of material. LL-37: molecular formula C₂₀₅H₃₄₀N₆₀O₅₃, molecular weight 4,493.3 g/mol, CAS 154947-66-7. Released to a specification of >99% purity by HPLC. Soluble in bacteriostatic water. Supplied for in-vitro laboratory research only. Not a drug, food or supplement. Not for human or veterinary use.

Volta does not provide dosing, administration or protocol guidance for any material listed.

LL-37 5mg specifications

Every field the product record holds. A field with no value is omitted rather than printed as a dash.

Fill
5mg
Form
Lyophilized powder
CAS number
154947-66-7
Molecular formula
C₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight
4,493.3 g/mol
Solubility
Soluble in bacteriostatic water
Shelf life
24 months from date of manufacture

LL-37 analytical verification and batch documentation

What the purity figure on this page is, who measured what, and which of the two a reader is looking at.

Specification. Every batch is released to >99% purity by HPLC. That is a threshold Volta sets, and it is a promise rather than a measurement.

Measurement. No certificate for this compound is published on the site yet. A batch-specific Certificate of Analysis is available on request, and the batch history lists the ones already published. Until one is published for this material, the figure above is the release specification and nothing on this page is a laboratory result.

Checking a certificate. The batch number printed beside the price is derived from the compound code and the vial strength; the lot number on a certificate is transcribed from the document. They are produced independently, so comparing them is a real check. How to read one is set out in the quality and testing methodology page.

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease.

LL-37 works through charge and shape rather than through a receptor: its cationic amphipathic helix inserts into anionic bacterial membranes and disrupts them, a mechanism that makes resistance development slow compared with conventional antibiotics. Alongside that direct activity it acts as a signalling molecule, driving chemotaxis, angiogenesis and re-epithelialisation, and it is this dual role that makes it interesting in wound-healing models. It is also implicated in the pathology of psoriasis and rosacea, so the literature cuts both ways. This 5mg vial is sized for the low working concentrations typical of antimicrobial assays.

  • Released to a >99% purity specification by HPLC
  • Lyophilized powder, 5mg per vial
  • Soluble in bacteriostatic water
  • For laboratory research use only

Frequently Bought Together

LL-37 5mg
This item

LL-37 5mg

5mg

$57 USD

Bundle & Save

2
2 items

$92 USD

Save $4.60 USD

3
3 items

$138 USD

Save $13.80 USD

4
4 items

$207 USD

Save $31.05 USD

5
5 items

$281 USD

Save $56.20 USD

Your selection (5 items)
$281 USDSave $56.20 USD

Click any product above to toggle selection

Related research materials

BPC-157 5mg
BPC-157 5mg

Healing & Recovery Research Peptides · 5mg

$35 USD
BPC-157 10mg
BPC-157 10mg

Healing & Recovery Research Peptides · 10mg

$46 USD
TB-500 10mg
TB-500 10mg

Healing & Recovery Research Peptides · 10mg

$69 USD
SS-31 10mg
SS-31 10mg

Healing & Recovery Research Peptides · 10mg

$49 USD
Tesamorelin 10mg
Tesamorelin 10mg

Growth Hormone Research Peptides · 10mg

$74 USD
CJC-1295 No DAC + Ipamorelin 10mg (5+5)
CJC-1295 No DAC + Ipamorelin 10mg (5+5)

Growth Hormone Research Peptides · 10mg

$49 USD
Ipamorelin 5mg
Ipamorelin 5mg

Growth Hormone Research Peptides · 5mg

$36 USD
GHRP-2 5mg
GHRP-2 5mg

Growth Hormone Research Peptides · 5mg

$28 USD

LL-37 5mg: what is in the vial

The arithmetic specific to this 5mg vial, and what a milligram of LL-37 costs in each strength the catalogue carries. Concentrations are stated, not recommended.

Vial contents

5 mg

Lyophilised powder, reconstituted by the buyer

Cost of material

$11.40 / mg USD

CA$16.40 / mg in Canadian dollars

Concentration at each diluent volume

5 mg of dry material reaches these concentrations in the volumes below. A U-100 syringe marking is 0.01 ml by definition, so the last column is a unit conversion at each concentration rather than a quantity to use.

Diluent addedConcentrationIn 0.1 mlPer U-100 unit
1 ml5 mg/ml500 mcg50 mcg
2 ml2.5 mg/ml250 mcg25 mcg
3 ml1.67 mg/ml166.7 mcg16.7 mcg
5 ml1 mg/ml100 mcg10 mcg

For a volume this table does not list, the reconstitution calculator takes any vial size and diluent volume.

LL-37 purity and identity: how the figure is measured

What >99% (HPLC) means, the masses an identity check has to land on, and the entries that make a certificate of analysis checkable rather than decorative.

Stated purity

>99% (HPLC)

Area percent of the main peak by reversed-phase HPLC

Average mass

4,493.3 g/mol

The figure an identity check has to land on

Identity by mass: the ions to expect

An electrospray source protonates the molecule rather than weighing it neutral, so a spectrum shows a series of charge states rather than the molecular weight itself. These are the m/z values 4,493.3 g/mol produces, and they are what a mass spectrum on a certificate for LL-37 has to match.

IonChargeExpected m/z
[M+H]+1+4,494.31
[M+2H]2+2+2,247.66
[M+3H]3+3+1,498.77

A peptide this size is normally reported at its doubly and triply charged states, and the singly charged ion may not appear at usable intensity at all. A spectrum showing only one of these is not a failed identity check.

What a certificate for LL-37 should carry

A purity percentage on its own is not checkable. These are the entries that make one verifiable, and their absence is the most common weakness in a research-peptide certificate.

  • The chromatogram, not only the number

    A stated area percent with no trace behind it cannot be read for the shape of the main peak or for what eluted beside it. The HPLC interpreter walks through what a trace shows.

  • Net peptide content, separately from gross mass

    A lyophilised peptide is a salt, usually of trifluoroacetic or acetic acid, plus residual water. The vial's stated milligrams are gross; net peptide content is the fraction of that mass which is the molecule. The two differ by ten to twenty percent routinely, and only one of them is what the price is per milligram of. The net peptide content calculator converts between them.

  • The counterion, named

    Which salt form the powder is in changes the net content and the pH the powder dissolves at. A certificate that never names it leaves both unknowable.

  • Water content, by a stated method

    Loss on drying and Karl Fischer titration give different numbers, and a water figure with no method attached cannot be compared with anyone else's.

  • A laboratory and a report identifier

    Without both, nothing on the document can be traced back to the laboratory that issued it. The red flag checker lists the rest.

Batch certificates are published as page images in the certificate library. The source PDFs are never served: a certificate is the most forgeable document a supplier publishes, and an editable copy carrying an accredited laboratory's letterhead is worth more to a counterfeiter than to a customer.

LL-37 storage and stability

Handling as the product record states it, followed by the degradation chemistry this particular sequence is and is not exposed to.

Handling

Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.

What degrades this compound

Each of these follows from the molecule itself rather than from general peptide handling.

  • Interfacial and surface loss

    4,493.3 g/mol, above the 3,500 g/mol range where this dominates

    A peptide this size unfolds at boundaries. It adsorbs to glass and to polypropylene, and it denatures at the air-water interface that shaking creates, which is why a vial is swirled rather than vortexed and why the diluent is run down the vial wall instead of squirted onto the powder. The failure is quiet: interfacial loss removes material without changing what is left behind, so the solution still assays clean at a concentration lower than the arithmetic says.

LL-37 compared with BPC-157 and Thymalin

Pharmacological class, half-life, evidence grade, competition status and cost per milligram, side by side.

CompoundClassHalf-lifeEvidenceWADACheapest per mg
LL-37this pageAntimicrobial / ImmuneMinutes in plasma; tissue activity persists longerDPreclinicalNot listed$11.405mg vial, out of stock
BPC-157Healing & Recovery~15 min IV (animal data); oral activity persists 24+ hoursCPhase I–II Clinical TrialsProhibited$4.6010mg vial
ThymalinImmune / Anti-Aging~30-60 minutes (short peptide complex)CEarly Human or Mixed EvidenceNot listed$4.2010mg vial, out of stock
Thymosin Alpha-1Immune Modulator~2 hoursCPhase I–II Clinical TrialsProhibited$5.7010mg vial, out of stock
SS-31Metabolic / Mitochondrial~4 hoursAFDA ApprovedNot listed$4.9010mg vial

Evidence grades and half-lives are as recorded in the compound database, which cites its own sources on each compound page. Per-milligram prices are the cheapest strength each compound is currently listed at, in US dollars, and an out-of-stock note means that figure is not purchasable today. Cross-trial comparisons of efficacy are not comparisons: no head-to-head trial exists for most of these pairs.

LL-37 in Canada

Price in Canadian dollars, where the parcel ships from, and how long it takes.

Price in CAD

CA$82

The figure charged, not a converted estimate

Ships from

British Columbia

A domestic parcel, so no import clearance step

Transit

2 to 5 business days

After 1 to 2 business days of handling

Free standard shipping

Over CA$250

A bar set for this market, not converted from the US one

LL-37 5mg ships from British Columbia to Canadian addresses, so the parcel never crosses a border. That removes the failure a Canadian buyer of research peptides is usually weighing: an inbound international shipment can be held for import clearance or seized, and a domestic one has no clearance step to be held at.

Shipping is quoted live against the delivery address at checkout rather than estimated here, and both the standard and express tiers show their price and transit window before a payment method is chosen. The figure the page shows is the figure the rail charges: all three settlement rails price shipping through the same functions the quote does.

The Canadian figure above is not a loose conversion. Each product's US dollar base is chosen so that the live conversion lands on the Canadian shelf price set for this market, and the result is pushed up to a whole dollar rather than left carrying cents, so one figure serves the page, the feed and every payment rail. See the shipping policy for carriers and cut-off times, and the legal position on research peptides in Canada for the regulatory picture.

What is LL-37?

LL-37 is the only cathelicidin that humans produce. The CAMP gene on chromosome 3p21.3 encodes a 170-residue precursor called hCAP18, which carries a conserved cathelin-like domain across residues 31 to 131 and the active peptide at its C-terminus, residues 134 to 170 (UniProt P49913). Those 37 residues open with two leucines, and that is the whole of the name: LL, then 37. The free peptide has a molecular weight of 4,493.3 g/mol, a formula of C205H340N60O53, and a net charge near +6 at neutral pH. The charge, paired with a hydrophobic face on the opposite side of the helix, does most of the work.

The precursor is not active. Sorensen and colleagues (2001) showed that hCAP18 survives phagocytosis inside the neutrophil intact and is only cleaved once it has been exocytosed, and that of the three serine proteases in azurophil granules, proteinase 3 alone performs the cut. A second, unrelated activation route exists: seminal plasma carries hCAP18 in its inactive form, and the prostate protease gastricsin cleaves it at vaginal pH to ALL-38, a 38-residue peptide with antimicrobial activity equal to LL-37 (Sorensen et al., 2003). UniProt lists further processed forms including FALL-39, LL-23, FF-33, RK-31, KS-30 and KR-20, which matters to anyone characterising a sample: the tissue does not make one peptide, it makes a family, and only the 134 to 170 species is LL-37.

The literature on this peptide is unusually deep and it cuts in both directions. The same molecule that Nizet and colleagues (2001) showed protects mouse skin from necrotic Group A Streptococcus infection is the one Lande and colleagues (2007) identified as the factor that lets plasmacytoid dendritic cells mistake host DNA for a pathogen in psoriasis, and that Yamasaki and colleagues (2007) found abnormally processed and abnormally abundant in rosacea skin. LL-37 holds no marketing authorisation in any jurisdiction. The furthest it has been taken clinically is a topical Phase 2b programme in venous leg ulcers that missed its primary endpoint, and it is supplied here as a research reagent only.

LL-37 Mechanism of Action

The bactericidal action of LL-37 has no receptor. It is a physical chemistry problem: a cationic peptide that folds into an amphipathic helix only when the ionic environment permits, and then partitions into any membrane whose surface is negative enough to hold it. Johansson and colleagues (1998) mapped that dependence by circular dichroism. At micromolar concentration in plain water LL-37 is disordered. Adding 15 mM bicarbonate, sulfate or trifluoroacetate drives helix formation with roughly equal efficiency, while 160 mM chloride does so much less efficiently. The transition from disorder to helix is cooperative with rising peptide concentration, which is the signature of oligomer formation, and the extent of helicity tracks antibacterial activity against both Gram-positive and Gram-negative organisms. Below pH 5 the helical content falls away and at pH 2 the peptide is entirely disordered, while at pH above 13 the helix is retained.

Wang (2008) determined the high-resolution NMR structure of uniformly 13C and 15N labelled LL-37 in SDS micelles and found a curved amphipathic helix-bend-helix motif spanning residues 2 to 31, with the bend located between Gly-14 and Glu-16 and a disordered C-terminal tail. In dioctanoylphosphatidylglycerol micelles the aromatic rings of Phe-5, Phe-6, Phe-17 and Phe-27, along with the arginines, gave intermolecular nuclear Overhauser effects with the lipid, direct evidence that the entire helix lies against the anionic surface rather than inserting end-on. The same work identified KR-12, residues 18 to 29, as the shortest fragment retaining antibacterial activity, and showed that unlike the parent peptide it is selectively toxic to bacteria and not to human cells.

How the bound peptide breaks the membrane is best described by the carpet model rather than by a discrete pore. Oren and colleagues (1999) used polarised attenuated total reflectance Fourier-transform infrared spectroscopy and found LL-37 predominantly helical and oriented nearly parallel to the surface of zwitterionic-lipid membranes, an orientation incompatible with a transmembrane channel and consistent with detergent-like disruption once surface coverage passes a threshold. The same study found LL-37 in equilibrium between monomers and oligomers in solution at very low concentrations, significantly resistant to proteolysis both free and membrane-bound, and showed that the N-terminal residues govern proteolytic resistance and haemolytic activity but not antimicrobial potency. That dissociation is the reason N-truncated analogues behave so differently on host cells than on bacteria.

Alongside the membrane chemistry, LL-37 is a signalling ligand, and here it does use a receptor. Yang and colleagues (2000) showed that it is chemotactic for human monocytes, neutrophils and T lymphocytes, mobilises calcium in monocytes and in FPRL1-transfected HEK293 cells, and is cross-desensitised by an FPRL1-specific agonist, identifying formyl peptide receptor-like 1, now FPR2, as the receptor. Koczulla and colleagues (2003) then found the same receptor on endothelial cells, where LL-37 drove proliferation and vessel-like structure formation. A third mode is neither membranolytic nor receptor-mediated: LL-37 binds nucleic acids and condenses them into aggregates, which changes how the immune system reads them. That single property underlies both its endotoxin-neutralising activity and, on the wrong substrate, its role in autoimmunity.

The immunological output is not simply pro-inflammatory. Scott and colleagues (2002) profiled macrophage gene expression and found LL-37 directly up-regulating 29 genes and down-regulating 20, inducing monocyte chemoattractant protein 1 in macrophages and mouse lung and interleukin-8 in A549 epithelial cells and in whole human blood, while leaving TNF-alpha unchanged. It recruits without igniting. In the same study the peptide blocked macrophage stimulation by lipopolysaccharide, lipoteichoic acid and non-capped lipoarabinomannan, and protected mice against lethal endotoxaemia.

  1. Anion-dependent folding

    The peptide is disordered in dilute aqueous solution and adopts its helix only in the presence of sufficient anion. Bicarbonate, sulfate and trifluoroacetate at 15 mM each induce it with similar efficiency; chloride at 160 mM is markedly less effective (Johansson et al., 1998).

  2. Electrostatic capture

    The +6 net charge binds anionic microbial surfaces: lipopolysaccharide, lipoteichoic acid and phosphatidylglycerol headgroups. Mammalian outer leaflets are largely zwitterionic, which is the basis of what selectivity the peptide has.

  3. Carpet-like permeabilisation

    Bound helices lie nearly parallel to the bilayer surface and disrupt it in detergent-like fashion once surface coverage passes a threshold, rather than assembling a defined transmembrane pore (Oren et al., 1999).

  4. Endotoxin sequestration

    LL-37 binds E. coli lipopolysaccharide with positive cooperativity, Hill coefficient 2.02 (Turner et al., 1998). The homologous CAP18(104-140) fragment inhibited LPS-induced nitric oxide release and tissue factor generation and protected mice from LPS lethality (Larrick et al., 1995).

  5. FPR2 signalling

    Chemotaxis of neutrophils, monocytes and T cells through formyl peptide receptor-like 1, and proliferation plus tube formation in endothelial cells through the same receptor (Yang et al., 2000; Koczulla et al., 2003).

  6. Nucleic acid complexation

    LL-37 condenses extracellular DNA into aggregated structures that are retained in early endosomes of plasmacytoid dendritic cells, where they engage TLR9 and trigger type I interferon (Lande et al., 2007).

LL-37 Key Benefits

Every entry names the model the observation came from. LL-37 is one of the most thoroughly characterised antimicrobial peptides in existence and also one of the most context-dependent, so the model matters more here than it does for most compounds in this catalogue.

Broad-spectrum membrane disruption

Turner and colleagues (1998) reported minimum inhibitory concentrations of 0.6 micrograms per millilitre against E. coli ML-35p in low salt, 1.3 to 5.7 against Pseudomonas aeruginosa and 2.9 to 12.5 against Staphylococcus aureus strains. Johansson and colleagues (1998) independently put the MIC against E. coli at 5 micromolar. Because the mechanism is physical rather than target-based, resistance selection is slower than for conventional antibiotics, though it is not absent.

In vitro

Biofilm inhibition far below the growth-inhibitory concentration

Overhage and colleagues (2008) found LL-37 prevented Pseudomonas aeruginosa biofilm formation at 0.5 micrograms per millilitre, 128-fold below its MIC of 64 micrograms per millilitre in that system, by reducing cell attachment, stimulating twitching motility, and down-regulating the Las and Rhl quorum sensing systems. It also acted on pre-grown biofilms. The murine homologue CRAMP, which shares 67 percent identity, did not reproduce the effect.

In vitro

Activity against staphylococcal biofilm on implant material

Kang, Dietz and Li (2019) grew 24-hour S. aureus biofilms on cobalt-chromium discs in a CDC biofilm reactor and measured more than a 4 log reduction in colony counts with LL-37, against less than 1 log for silver nanoparticles and for conventional antibiotics. Adding rifampicin improved the comparators but did not close the gap.

In vitro

Endotoxin neutralisation and protection from lethal endotoxaemia

Scott and colleagues (2002) showed LL-37 blocking macrophage activation by lipopolysaccharide, lipoteichoic acid and non-capped lipoarabinomannan, and protecting mice against lethal endotoxaemia. Larrick and colleagues (1995) had already shown the C-terminal CAP18 fragment inhibiting LPS-induced nitric oxide release and tissue factor generation and rescuing mice from LPS lethality.

Rodent model

Leukocyte recruitment through FPR2

LL-37 is chemotactic for human peripheral blood neutrophils, monocytes and T lymphocytes and mobilises calcium in FPRL1-transfected HEK293 cells, with cross-desensitisation by an FPRL1-specific agonist confirming the receptor (Yang et al., 2000). Zheng and colleagues (2007) added that it drives IL-8 production through p38 and ERK, generates reactive oxygen species via NADPH oxidase, and triggers release of the alpha-defensins HNP1 to 3 from human neutrophils.

In vitro

Angiogenesis and re-epithelialisation in wound models

Koczulla and colleagues (2003) produced neovascularisation with LL-37 in the chick chorioallantoic membrane assay and in a rabbit hind-limb ischaemia model, and found reduced wound vascularisation in mice deficient for CRAMP. Heilborn and colleagues (2003) showed hCAP18 in human skin peaking 48 hours after wounding and returning to baseline on closure, absent from the epithelium at the edge of chronic ulcers, and showed that an affinity-purified anti-LL-37 antibody inhibited re-epithelialisation in organ-cultured human skin concentration-dependently, with loss of Ki67 staining in the blocked epithelium.

Rodent model

A measurable but non-replicated effect on chronic wound closure

In the first-in-man trial, topical LL-37 applied twice weekly at 0.5 mg/mL gave a healing rate constant roughly six times placebo in hard-to-heal venous leg ulcers (p = 0.003), with mean ulcer area falling 68 percent (Gronberg et al., 2014). The larger Phase 2b trial did not reproduce that in the full cohort: confirmed closure rates were 26.5, 24.7 and 25.3 percent for 0.5 mg/mL, 1.6 mg/mL and placebo (Mahlapuu et al., 2021). A post-hoc subgroup of ulcers of 10 square centimetres or larger showed 28.1 percent closure against 8.1 percent for placebo (p = 0.0458).

Phase 2 trial

Vitamin D control of endogenous cathelicidin production

The CAMP promoter contains a consensus vitamin D response element bound by the vitamin D receptor, and 1,25-dihydroxyvitamin D3 strongly induces CAMP in myeloid leukaemia lines, immortalised keratinocytes, colon cancer lines and normal human bone marrow macrophages (Gombart et al., 2005). Liu and colleagues (2006) showed Toll-like receptor activation of human macrophages up-regulating the vitamin D receptor and the 1-hydroxylase, inducing cathelicidin, and killing intracellular Mycobacterium tuberculosis, with low 25-hydroxyvitamin D sera failing to support that induction.

Mechanistic

LL-37 Molecular Information

Sequence (one letter)[LL-37, 37 aa]
Sequence (three letter)Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Length37 residues
Molecular FormulaC205H340N60O53
Molecular Weight4,493.3 g/mol
CAS Number154947-66-7
PubChem CID16198951
UniProtP49913 (CAMP_HUMAN), LL-37 chain at residues 134 to 170
GeneCAMP, chromosome 3p21.3
PrecursorhCAP18, 170 residues, cathelin-like domain at residues 31 to 131
Net ChargeApproximately +6 at pH 7.4
Secondary StructureAmphipathic helix-bend-helix spanning residues 2 to 31 in SDS micelles, bend between Gly-14 and Glu-16, disordered C-terminal tail
Physical FormWhite lyophilised powder
Related Processed FormsKR-12 (residues 18 to 29), KR-20, KS-30, RK-31, FF-33, LL-23, FALL-39, ALL-38

LL-37 Research History

The peptide arrived from two directions at once in the mid-1990s. Larrick and colleagues (1995) cloned human CAP18 from a bone marrow cDNA library using probes designed against the rabbit sequence, described a protein made of a 30-residue signal peptide, a 103-residue N-terminal domain of then-unknown function, and a 37-residue C-terminal antimicrobial domain, and showed that synthetic CAP18(104-140) bound LPS-coated erythrocytes, blocked LPS-induced nitric oxide and tissue factor generation, and protected mice from LPS lethality. In the same period the Swedish group of Agerberth and Gudmundsson identified the same C-terminal region as FALL-39, named for its first four residues and its length as then assigned. The two names converged once the processing site was pinned down.

The cathelin-like domain that occupies most of the precursor is the family signature: every cathelicidin across mammals carries a conserved pro-region of this kind attached to a wildly variable C-terminal effector. In cattle and pigs the effector is released by neutrophil elastase. Sorensen and colleagues (2001) showed that human biology does it differently, using proteinase 3 and doing it outside the cell after exocytosis rather than inside the phagolysosome. Immunoelectron microscopy put hCAP18 and the azurophil granule proteins together in the phagolysosome, yet immunoblotting found no cleavage there; the cut appeared only in exocytosed material. That finding reframed LL-37 from an intracellular killing agent into an extracellular one, which is consistent with everything later established about its signalling roles in the wound bed and on the airway surface.

Bals and colleagues (1998) localised LL-37/hCAP18 transcripts by in situ hybridisation to the surface epithelium of the conducting airway and to serous and mucous cells of the submucosal glands, and recovered antimicrobially active peptide from human airway surface fluid and from a bronchial xenograft model. Nizet and colleagues (2001) then supplied the genetic proof of relevance in vivo, combining mice lacking Cnlp, the gene for the murine homologue CRAMP, with Group A Streptococcus mutants, and showing that cathelicidin is a real component of cutaneous host defence rather than an in vitro curiosity. Those two papers are why the field takes the peptide seriously despite how easily it is inactivated in a test tube.

How LL-37 Kills, and Why It Often Does Not

The activity of LL-37 is conditional in a way that few research peptides are, and understanding the conditions is the difference between an interpretable assay and an uninterpretable one. Ionic strength is the first variable. Turner and colleagues (1998) measured the MIC against E. coli ML-35p rising from 0.6 to 7.6 micrograms per millilitre when 100 mM NaCl was added, a more than tenfold loss, although in radial diffusion underlay gels containing 100 mM NaCl the peptide retained activity against most organisms tested, with MRSA the exception. Bals and colleagues (1998) independently reported NaCl sensitivity of killing at the airway surface, alongside synergy with lactoferrin and lysozyme.

Serum is the second and larger problem. Johansson and colleagues (1998) noted that in solutions matching the ion composition of plasma, interstitial fluid or intracellular fluid, LL-37 is helical and therefore in principle active, but that human serum inhibits both its antibacterial and its cytotoxic activity. Wang and colleagues (1998) identified why. Affinity chromatography on an LL-37 column pulled out a single 26 kDa band, sequenced as apolipoprotein A-I. Surface plasmon resonance put the interaction in the low micromolar range, 50 micromolar apoA-I accounted for about half of the inhibition plasma exerts on 50 micromolar LL-37, and anti-apoA-I IgG completely blocked plasma inhibition up to 25 micromolar peptide. Sorensen and colleagues (1999) extended the picture to the precursor: plasma hCAP18 is carried on lipoproteins, delipidated plasma retains under 1 percent of it, and the binding is mediated by the same C-terminal region.

Those findings together explain the shape of the whole field. LL-37 is an excellent surface-acting peptide in the environments where the body actually deploys it, which are the sweat film, the airway lining fluid, the wound bed and the zone immediately outside a degranulating neutrophil, and a poor one in bulk plasma, where lipoproteins scavenge it. It is also why nearly every attempt to develop the molecule has been topical, and why analogue work concentrates on shortened, stapled or D-substituted derivatives that resist both proteolysis and lipoprotein capture. Ridyard and Overhage (2021) list the four barriers plainly: synthesis cost, reduced activity in physiological environments, proteolytic susceptibility, and host cell toxicity, and add a fifth that is easy to miss, namely bacterial adaptive responses to sub-inhibitory peptide.

Vitamin D and the CAMP Gene

Of everything in the LL-37 literature, the regulatory finding is the most striking. Gombart, Borregaard and Koeffler (2005) showed that 1,25-dihydroxyvitamin D3 and three of its analogues induce CAMP transcription in acute myeloid leukaemia lines, immortalised keratinocytes, colon cancer lines, normal human bone marrow-derived macrophages and fresh bone marrow cells, acting through a consensus vitamin D response element in the CAMP promoter that is bound by the vitamin D receptor. The unusual part is comparative. That response element sits inside a short interspersed nuclear element and is conserved across primates but absent from the mouse, rat and canine genomes. Murine cells were not induced, and CAMP mRNA in vitamin D receptor-deficient mouse bone marrow was indistinguishable from wild type.

The functional consequence was demonstrated by Liu and colleagues (2006). Toll-like receptor activation of human macrophages up-regulated both the vitamin D receptor and the vitamin D 1-hydroxylase, which converts circulating 25-hydroxyvitamin D into the active hormone locally, leading to cathelicidin induction and killing of intracellular Mycobacterium tuberculosis. Sera from African-American donors, a group with recognised higher tuberculosis susceptibility, had low 25-hydroxyvitamin D and were inefficient at supporting cathelicidin mRNA induction in that assay.

Two practical implications follow for anyone designing work with this compound. First, a rodent model cannot be used to study vitamin D-driven cathelicidin induction, because rodents lack the response element; humanised CAMP transgenic mice were built specifically to work around that gap. Second, endogenous cathelicidin is a moving background in any human sample, varying with vitamin D status, infection, smoking and periodontal disease. That is exactly what most of the registered clinical studies naming LL-37 are measuring.

LL-37 in Wound Healing and the Venous Leg Ulcer Programme

The clinical case for LL-37 in wounds was built on an absence rather than a presence. Heilborn and colleagues (2003) showed hCAP18 rising in human skin after injury, peaking at 48 hours and falling to pre-injury levels once the wound closed, present in both the inflammatory infiltrate and the epithelium migrating over the wound bed, and then showed that in chronic ulcers hCAP18 levels are low and immunoreactivity is absent from the epithelium at the ulcer edge. Blocking the peptide with an affinity-purified antibody in a non-inflammatory ex vivo model of organ-cultured human skin inhibited re-epithelialisation in a concentration-dependent manner, and Ki67 staining disappeared from the epithelium of the blocked wounds. The peptide is not merely present during repair; the repair depends on it.

The first-in-man trial followed that logic. Gronberg and colleagues (2014) enrolled 34 participants with hard-to-heal venous leg ulcers, ran a three-week open-label placebo lead-in, then randomised to four weeks of twice-weekly topical LL-37 at 0.5, 1.6 or 3.2 mg/mL or placebo, with four weeks of follow-up. Healing rate constants at 0.5 and 1.6 mg/mL were approximately six-fold and three-fold that of placebo (p = 0.003 and p = 0.088), mean ulcer area fell 68 percent and 50 percent respectively, and the highest concentration, 3.2 mg/mL, was indistinguishable from placebo. That non-monotonic pattern is what the concentration-dependent host cytotoxicity of the peptide predicts, and it is one of the more informative results in the whole field.

The Phase 2b trial did not confirm it. Mahlapuu and colleagues (2021) randomised 149 patients across 15 sites in Poland and Sweden, mean age 67.6 years, median ulcer duration 20.3 months, mean wound size 11.6 square centimetres, to twice-weekly 0.5 mg/mL, 1.6 mg/mL or placebo for 13 weeks. Confirmed complete closure sustained at the two-week post-closure visit occurred in 26.5, 24.7 and 25.3 percent of the three arms. Nothing separated them, and the mean healing rates, 0.0261, 0.0112 and 0.0204 per day, did not either. An exploratory analysis of ulcers of 10 square centimetres or larger did separate: 28.1 percent closure against 8.1 percent for placebo (p = 0.0458), healing rate 0.0367 against 0.0093 per day (p = 0.0439), time to closure 87.4 against 97.5 days (p = 0.0066), and 47.2 percent against 16.2 percent achieving at least a 70 percent area reduction (p = 0.0149). Local reactions, mostly mild redness and oedema, occurred in 39 to 43 percent of patients with no consistent difference between the active arms and placebo. A subgroup finding from a trial that missed its primary endpoint is a hypothesis rather than a result, and the authors say so.

A second registered wound study, NCT04098562, is a Phase 2 trial of LL-37 cream at 0.5 mg/mL applied twice weekly for four weeks in diabetic foot ulcers, run by Universitas Indonesia, with granulation index, aerobic bacterial counts and IL-1 alpha and TNF-alpha as endpoints in 40 planned participants. No results have been posted to the registry.

The Other Side of LL-37: Psoriasis, Rosacea and Host Toxicity

Lande and colleagues (2007) asked why plasmacytoid dendritic cells, which normally ignore host DNA, respond to it in psoriatic skin, and found LL-37 to be the answer. The peptide binds host DNA into aggregated, condensed structures that are delivered to and retained within early endocytic compartments of the pDC, where they engage TLR9 and drive type I interferon production. The DNA has not changed; its packaging has. This is the same nucleic-acid-condensing property that underlies endotoxin neutralisation, operating on the wrong substrate, and it sits at the centre of a whole branch of psoriasis immunology. Later work extended the same logic to RNA associated with neutrophil extracellular traps.

Rosacea has an adjacent story with a different lesson. Yamasaki and colleagues (2007) found that people with rosacea express abnormally high cathelicidin in facial skin, and, more importantly, that the processed forms present are different from those in normal skin, because stratum corneum tryptic enzyme activity is elevated in the epidermis and cuts the precursor differently. Injecting the rosacea-associated peptide forms into mouse skin, adding the protease, or increasing protease activity by deleting the serine protease inhibitor gene Spink5 each increased inflammation, and mice with Camp deleted did not develop it. Processing, not abundance alone, is the determinant.

There is also a straightforward toxicity ceiling that no amount of formulation removes. Johansson and colleagues (1998) reported LL-37 cytotoxic to several eukaryotic cell types at 13 to 25 micromolar, against a MIC of 5 micromolar for E. coli, giving a window under a factor of five in the absence of serum. Oren and colleagues (1999) showed the peptide is haemolytic and that the N-terminal residues, which are dispensable for antimicrobial activity, are what confer that haemolysis. This is why fragment engineering has been so productive: KR-12, residues 18 to 29, retains antibacterial activity while losing toxicity toward human cells (Wang, 2008), and stapled KR-12 derivatives such as KR-12(Q5, D9) increase helical content and net charge, resist proteolysis, and raise the therapeutic index relative to the parent in an infected-wound mouse model (Zhang et al., 2024).

Zheng and colleagues (2007) complete the picture from the other side: LL-37 makes human neutrophils generate reactive oxygen species through NADPH oxidase, produce IL-8 under p38 and ERK control, and release the alpha-defensins HNP1 to 3. In an infected wound that is host defence. In psoriatic skin, where neutrophil infiltration is a defining feature, the same activity is amplification. Nothing about the molecule changes between those two settings, which is the honest summary of why a peptide this potent has taken thirty years to fail its way toward a topical indication.

LL-37 Compared With Other Compounds in the Healing and Recovery Category

LL-37 sits in the same catalogue category as BPC-157, TB-500 and GHK-Cu, but it works on a different axis and the comparison is worth making precisely. BPC-157 and TB-500 are studied as regenerative signalling peptides with no direct antimicrobial component, and neither is a human gene product with a defined receptor pharmacology. GHK-Cu carries a metal and acts largely on matrix gene expression. LL-37 is the only one of the group whose primary described activity is direct physical destruction of a microbial membrane, and the only one whose endogenous counterpart is under transcriptional control by a vitamin.

The nearest functional neighbour is not in the Healing and Recovery category at all but among the immune peptides: thymosin alpha-1, another human-derived peptide studied as an immunomodulator. The two differ in evidence weight in a way worth stating plainly. Thymosin alpha-1 has been through dozens of randomised trials and holds marketing authorisation in a number of countries. LL-37 has two published randomised topical wound trials, one positive at 34 participants and one null at 148, plus a Phase 1/2 intratumoral melanoma study at MD Anderson (NCT02225366) that enrolled 4 of a planned 36 participants before completing in November 2020, reporting no dose-limiting toxicities in the 3 evaluable participants across cohorts at 250 and 500 micrograms per tumour.

Within the LL-37 family itself the meaningful comparison is to its own fragments. KR-12 is the shortest sequence retaining antibacterial activity and is bacterially selective in a way the parent is not. KR-20, KS-30, RK-31 and FF-33 arise from further skin protease processing and each carries a different balance of antimicrobial to inflammatory activity, which is precisely what Yamasaki and colleagues found dysregulated in rosacea. ALL-38, the gastricsin product from seminal plasma, is 38 residues with equal antimicrobial potency. A vial labelled LL-37 that has been mis-synthesised or partially degraded is likely to contain one of these, which is why the analytical question below is not a formality.

LL-37 Handling, Solubility and Analytical Characterisation

LL-37 is supplied as a white lyophilised powder and is hygroscopic in that state. The lyophilised material is the well-characterised form: held desiccated at -20 degrees Celsius, protected from light and moisture, and brought to room temperature before the vial is opened so that condensation does not reach the powder. Aqueous stocks are held at 2 to 8 degrees Celsius, aliquoted for single use, and not cycled repeatedly through freezing and thawing. Two properties specific to this peptide deserve attention beyond the generic advice. It is strongly cationic, so it adsorbs to glass and to untreated polypropylene, and dilute working solutions lose measurable material to the container wall; low-binding tubes and a carrier protein or non-ionic detergent are the standard countermeasures in the membrane literature. And its conformation is anion-dependent, so the buffer is not neutral with respect to the result: a stock prepared in a bicarbonate or sulfate-containing buffer is more helical, and therefore more active, than the same nominal concentration in plain water.

The pH sensitivity documented by Johansson and colleagues (1998) is the other handling consequence. Helical content declines below pH 5 and is entirely lost at pH 2, which matters because trifluoroacetate is the standard counterion left by reverse-phase purification, and residual TFA both acidifies a stock and, at the concentrations it can reach, independently promotes helix formation. A peptide characterised as an acetate salt and one characterised as a trifluoroacetate salt are not interchangeable in a circular dichroism experiment, and net peptide content differs between them for a molecule carrying six positive charges.

Analytically, LL-37 poses a harder identity problem than most catalogue peptides because so many of its truncations are themselves biologically active and chromatographically close. Reverse-phase HPLC gives purity as a percentage of peak area; on its own it does not distinguish LL-37 from a des-Ser C-terminal deletion or from the shorter processed forms. Mass spectrometry is what separates them, and the average mass expected from C205H340N60O53 is 4,493.3, with a peptide carrying six positive charges giving a straightforward electrospray charge envelope. Because the sequence contains four phenylalanines and no tryptophan or tyrosine, ultraviolet quantitation at 280 nanometres is unavailable, and concentration must be established by amino acid analysis or by far-ultraviolet absorbance instead. That missing 280 nanometre chromophore is a real and frequently overlooked difference between LL-37 and most other peptides in this catalogue.

What the Registered Trial Record Actually Contains

Thirteen studies on ClinicalTrials.gov name LL-37, and reading the list is instructive because only a minority administer it. NCT02225366 (Phase 1/2, MD Anderson Cancer Center, intratumoral injection in stage IIIB, IIIC and IV M1a melanoma, completed November 2020) and NCT04098562 (Phase 2, diabetic foot ulcer cream, Universitas Indonesia) are the interventional entries. The venous leg ulcer programme that produced the 2014 and 2021 publications is the substantive clinical dataset, and it was run outside those two registrations.

The remaining registrations measure endogenous LL-37 as a biomarker. Several concern periodontal and peri-implant disease, where cathelicidin in gingival crevicular fluid and saliva is tracked against disease stage, smoking status and vitamin D level: NCT04404335, NCT04861493, NCT06867250, NCT07280754 and NCT04946617 sit in that group. NCT04292548 and NCT03639376 measure salivary LL-37 in children exposed to passive smoking. NCT03270709 was a Phase 1 high-dose vitamin D3 study in smokers with and without HIV that was terminated, and NCT02138591, a Phase 3 preoperative vitamin D supplementation trial, was also terminated.

The shape of that record is the honest position of the compound. LL-37 is far better established as a measurable component of human innate immunity, and as a biomarker of it, than as an administered agent. Its two randomised administration trials were both topical, both in chronic wounds, and produced a positive small trial followed by a null larger one. Anything claimed about systemic use is extrapolation from cell and rodent work.

LL-37 FAQ

LL-37 Research Summary

LL-37 is the human cathelicidin, a 37-residue cationic amphipathic peptide cut from hCAP18 by proteinase 3 after neutrophil degranulation. Its bactericidal mechanism is physical rather than target-based: an anion-dependent helix that binds anionic microbial surfaces and disrupts them in detergent-like fashion, with minimum inhibitory concentrations in the low micrograms per millilitre range in vitro and biofilm inhibition at concentrations more than a hundred-fold lower again. Alongside that it is a signalling ligand at FPR2, recruiting neutrophils, monocytes and T cells, driving endothelial proliferation and angiogenesis, and neutralising lipopolysaccharide well enough to protect mice from lethal endotoxaemia.

It is also the peptide that broke the field's assumption that more antimicrobial peptide is always better. It converts inert host DNA into a TLR9 agonist in psoriasis, its abnormally processed forms drive inflammation in rosacea, it is cytotoxic to human cells at roughly three to five times its antibacterial concentration, and it is scavenged in plasma by apolipoprotein A-I. Those constraints are why clinical development has stayed topical, and why the encouraging 34-patient venous leg ulcer trial of 2014 was not reproduced by the 148-patient Phase 2b of 2021.

For research use the practical points are these. The buffer anion and the ionic strength determine the conformation and therefore the activity. Serum abolishes both the antimicrobial and the cytotoxic effect. The cationic peptide is lost to container surfaces from dilute solution. And identity cannot be established by HPLC purity alone, because the biologically active truncations are chromatographically close and none of them is LL-37. The compound holds no marketing authorisation in any jurisdiction and is supplied for laboratory research only.

Scientific References

Primary literature and public trial registries only. No supplier or retailer pages are cited.

  1. 1Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3Sorensen OE, Follin P, Johnsen AH, Calafat J, Tjabringa GS, Hiemstra PS, Borregaard N · Blood · 2001
  2. 2Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micellesWang G · Journal of Biological Chemistry · 2008
  3. 3Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activityOren Z, Lerman JC, Gudmundsson GH, Agerberth B, Shai Y · Biochemical Journal · 1999
  4. 4Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37Johansson J, Gudmundsson GH, Rottenberg ME, Berndt KD, Agerberth B · Journal of Biological Chemistry · 1998
  5. 5Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophilsTurner J, Cho Y, Dinh NN, Waring AJ, Lehrer RI · Antimicrobial Agents and Chemotherapy · 1998
  6. 6Human CAP18: a novel antimicrobial lipopolysaccharide-binding proteinLarrick JW, Hirata M, Balint RF, Lee J, Zhong J, Wright SC · Infection and Immunity · 1995
  7. 7LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cellsYang D, Chen Q, Schmidt AP, Anderson GM, Wang JM, Wooters J, Oppenheim JJ, Chertov O · Journal of Experimental Medicine · 2000
  8. 8The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responsesScott MG, Davidson DJ, Gold MR, Bowdish D, Hancock REW · Journal of Immunology · 2002
  9. 9An angiogenic role for the human peptide antibiotic LL-37/hCAP-18Koczulla R, von Degenfeld G, Kupatt C, et al. · Journal of Clinical Investigation · 2003
  10. 10Human host defense peptide LL-37 prevents bacterial biofilm formationOverhage J, Campisano A, Bains M, Torfs ECW, Rehm BHA, Hancock REW · Infection and Immunity · 2008
  11. 11Antimicrobial peptide LL-37 is bactericidal against Staphylococcus aureus biofilmsKang J, Dietz MJ, Li B · PLOS ONE · 2019
  12. 12Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3Gombart AF, Borregaard N, Koeffler HP · The FASEB Journal · 2005
  13. 13Toll-like receptor triggering of a vitamin D-mediated human antimicrobial responseLiu PT, Stenger S, Li H, et al. · Science · 2006
  14. 14The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epitheliumHeilborn JD, Nilsson MF, Kratz G, Weber G, Sorensen O, Borregaard N, Stahle-Backdahl M · Journal of Investigative Dermatology · 2003
  15. 15Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trialGronberg A, Mahlapuu M, Stahle M, Whately-Smith C, Rollman O · Wound Repair and Regeneration · 2014
  16. 16Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: a multicentric prospective randomized placebo-controlled clinical trialMahlapuu M, Sidorowicz A, Mikosinski J, et al. · Wound Repair and Regeneration · 2021
  17. 17Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptideLande R, Gregorio J, Facchinetti V, et al. · Nature · 2007
  18. 18Increased serine protease activity and cathelicidin promotes skin inflammation in rosaceaYamasaki K, Di Nardo A, Bardan A, et al. · Nature Medicine · 2007
  19. 19Apolipoprotein A-I binds and inhibits the human antibacterial/cytotoxic peptide LL-37Wang Y, Agerberth B, Lothgren A, Almstedt A, Johansson J · Journal of Biological Chemistry · 1998
  20. 20The human antibacterial cathelicidin, hCAP-18, is bound to lipoproteins in plasmaSorensen O, Bratt T, Johnsen AH, Madsen MT, Borregaard N · Journal of Biological Chemistry · 1999
  21. 21Innate antimicrobial peptide protects the skin from invasive bacterial infectionNizet V, Ohtake T, Lauth X, et al. · Nature · 2001
  22. 22The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surfaceBals R, Wang X, Zasloff M, Wilson JM · Proceedings of the National Academy of Sciences · 1998
  23. 23Processing of seminal plasma hCAP-18 to ALL-38 by gastricsin: a novel mechanism of generating antimicrobial peptides in vaginaSorensen OE, Gram L, Johnsen AH, et al. · Journal of Biological Chemistry · 2003
  24. 24Cathelicidin LL-37 induces the generation of reactive oxygen species and release of human alpha-defensins from neutrophilsZheng Y, Niyonsaba F, Ushio H, Nagaoka I, Ikeda S, Okumura K, Ogawa H · British Journal of Dermatology · 2007
  25. 25The potential of human peptide LL-37 as an antimicrobial and anti-biofilm agentRidyard KE, Overhage J · Antibiotics · 2021
  26. 26Discovery of novel antibacterial agent for the infected wound treatment: all-hydrocarbon stapling optimization of LL-37Zhang Y, Zheng M, Wang Z, et al. · Theranostics · 2024
  27. 27Induction of antitumor response in melanoma patients using the antimicrobial peptide LL37 (NCT02225366)M.D. Anderson Cancer Center · ClinicalTrials.gov · 2020
  28. 28Efficacy of LL-37 cream on bacteria colonization, inflammation response and healing rate of diabetic foot ulcers (NCT04098562)Universitas Indonesia · ClinicalTrials.gov · 2019
  29. 29CAMP, cathelicidin antimicrobial peptide (hCAP18), Homo sapiensUniProt Consortium · UniProtKB entry P49913 · 2026

Disclaimer

All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are furnished for in-vitro studies only. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease.

LL-37 5mg: frequently asked questions

Answered from the product record and the certificate file. Volta does not answer questions about administration, dosing or protocols.

What is supplied in a 5 mg vial of LL-37?

A sealed single-use vial containing 5 mg of LL-37 as a lyophilized powder. Soluble in bacteriostatic water. No diluent, syringe or other supply is included.

Is LL-37 supplied for human use?

No. For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Volta does not provide dosing, administration or protocol guidance for any material listed.

What purity is this LL-37 released to?

>99% by HPLC. That figure is a release specification, a threshold Volta sets for every batch, and it is not the same kind of statement as a purity measured by a named laboratory for a named lot.

Is there a certificate of analysis for this LL-37 vial?

A batch-specific Certificate of Analysis is available for this product on request. It is not published on the site yet: the batch history on the quality page lists the certificates already published, and this vial is covered by the release specification until its own is added there.

How is LL-37 identified?

CAS 154947-66-7, molecular formula C₂₀₅H₃₄₀N₆₀O₅₃, molecular weight 4,493.3 g/mol. Those identifiers are what an incoming-goods check compares a certificate against, and they are stated here so the comparison can be made before ordering.

How should LL-37 be stored before reconstitution?

Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.

Where does this ship from?

British Columbia, Canada. Canadian orders are domestic, so they clear no customs and pay no import duty. International orders ship from the same facility.

More from the research catalogue

Every compound below has its own specification, batch number and certificate page, whether or not a vial is in stock today. Supplied for laboratory research use only.

Related research compounds

Browse all healing & recovery peptides

Your Cart

Your cart is empty

Browse our catalog to add research compounds.