Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|
PE 22-28 10mg specification card: catalogue number, CAS number, molecular formula and purity

PE 22-28 10mg Peptide

For in-vitro laboratory research only. Not for human or animal administration.

Batch #: VPPE10100

$54 USD

Get Notified When Available

This product is currently out of stock. Enter your email and we'll notify you the moment it's back.

Application formLyophilized powder
StorageRefrigerated
Purity>99%
Weight10mg

Research Use Only

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Batch-specific Certificates of Analysis available for all products.

PE 22-28 10mg: overview

What the vial contains and what the material is, stated as specifications rather than as outcomes.

PE 22-28 supplied as a lyophilized powder in a sealed single-use vial containing 10 mg of material. Released to a specification of >99% purity by HPLC. Soluble in bacteriostatic water. Supplied for in-vitro laboratory research only. Not a drug, food or supplement. Not for human or veterinary use.

Volta does not provide dosing, administration or protocol guidance for any material listed.

PE 22-28 10mg specifications

Every field the product record holds. A field with no value is omitted rather than printed as a dash.

Fill
10mg
Form
Lyophilized powder
Solubility
Soluble in bacteriostatic water
Shelf life
24 months from date of manufacture

PE 22-28 analytical verification and batch documentation

What the purity figure on this page is, who measured what, and which of the two a reader is looking at.

Specification. Every batch is released to >99% purity by HPLC. That is a threshold Volta sets, and it is a promise rather than a measurement.

Measurement. No certificate for this compound is published on the site yet. A batch-specific Certificate of Analysis is available on request, and the batch history lists the ones already published. Until one is published for this material, the figure above is the release specification and nothing on this page is a laboratory result.

Checking a certificate. The batch number printed beside the price is derived from the compound code and the vial strength; the lot number on a certificate is transcribed from the document. They are produced independently, so comparing them is a real check. How to read one is set out in the quality and testing methodology page.

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease.

TREK-1 knockout animals show a depression-resistant phenotype, which made the channel an attractive target and led to the identification of spadin as an endogenous blocker. PE 22-28 is the minimal active fragment of that peptide, retaining channel-blocking activity at a fraction of the length. What makes it interesting mechanistically is the reported speed of onset in animal models, on the order of days rather than the weeks associated with monoaminergic antidepressants, which points to a distinct pathway. Independent replication outside the originating groups remains limited.

  • Released to a >99% purity specification by HPLC
  • Lyophilized powder, 10mg per vial
  • Soluble in bacteriostatic water
  • For laboratory research use only

Frequently Bought Together

PE 22-28 10mg
This item

PE 22-28 10mg

10mg

$54 USD

Bundle & Save

2
2 items

$138 USD

Save $6.90 USD

3
3 items

$177 USD

Save $17.70 USD

4
4 items

$221 USD

Save $33.15 USD

5
5 items

$295 USD

Save $59 USD

Your selection (5 items)
$295 USDSave $59 USD

Click any product above to toggle selection

Related research materials

KLOW 80mg
KLOW 80mg

Wellness Research Peptides · 80mg

$84 USD
KPV 10mg
KPV 10mg

Wellness Research Peptides · 10mg

$39 USD
HCG 5,000iu
HCG 5,000iu

Wellness Research Peptides · 5,000iu

$44 USD
MOTS-C 10mg
MOTS-C 10mg

Wellness Research Peptides · 10mg

$32 USD
Epithalon 10mg
Epithalon 10mg

Wellness Research Peptides · 10mg

$34 USD
DSIP 10mg
DSIP 10mg

Wellness Research Peptides · 10mg

$46.71 USD
Tesamorelin 10mg
Tesamorelin 10mg

Growth Hormone Research Peptides · 10mg

$74 USD
CJC-1295 No DAC + Ipamorelin 10mg (5+5)
CJC-1295 No DAC + Ipamorelin 10mg (5+5)

Growth Hormone Research Peptides · 10mg

$49 USD

PE 22-28 10mg: what is in the vial

The arithmetic specific to this 10mg vial, and what a milligram of PE 22-28 costs in each strength the catalogue carries. Concentrations are stated, not recommended.

Vial contents

10 mg

Lyophilised powder, reconstituted by the buyer

Cost of material

$5.40 / mg USD

CA$7.70 / mg in Canadian dollars

Concentration at each diluent volume

10 mg of dry material reaches these concentrations in the volumes below. A U-100 syringe marking is 0.01 ml by definition, so the last column is a unit conversion at each concentration rather than a quantity to use.

Diluent addedConcentrationIn 0.1 mlPer U-100 unit
1 ml10 mg/ml1 mg100 mcg
2 ml5 mg/ml500 mcg50 mcg
3 ml3.33 mg/ml333.3 mcg33.3 mcg
5 ml2 mg/ml200 mcg20 mcg

For a volume this table does not list, the reconstitution calculator takes any vial size and diluent volume.

PE 22-28 purity and identity: how the figure is measured

What >99% (HPLC) means, the masses an identity check has to land on, and the entries that make a certificate of analysis checkable rather than decorative.

Stated purity

>99% (HPLC)

Area percent of the main peak by reversed-phase HPLC

Detection

280 nm

A 1 mg/ml solution reads about 7.11 AU in a 1 cm cell

Why 280 nm

The sequence carries 1 Trp, so it absorbs at 280 nm as well as at 214 nm on the peptide bond.

This matters when reading someone else's certificate: a purity figure quoted at 280 nm for a compound with no aromatic residue is measuring an absorbance the molecule does not have.

What a certificate for PE 22-28 should carry

A purity percentage on its own is not checkable. These are the entries that make one verifiable, and their absence is the most common weakness in a research-peptide certificate.

  • The chromatogram, not only the number

    A stated area percent with no trace behind it cannot be read for the shape of the main peak or for what eluted beside it. The HPLC interpreter walks through what a trace shows.

  • Net peptide content, separately from gross mass

    A lyophilised peptide is a salt, usually of trifluoroacetic or acetic acid, plus residual water. The vial's stated milligrams are gross; net peptide content is the fraction of that mass which is the molecule. The two differ by ten to twenty percent routinely, and only one of them is what the price is per milligram of. The net peptide content calculator converts between them.

  • The counterion, named

    Which salt form the powder is in changes the net content and the pH the powder dissolves at. A certificate that never names it leaves both unknowable.

  • Water content, by a stated method

    Loss on drying and Karl Fischer titration give different numbers, and a water figure with no method attached cannot be compared with anyone else's.

  • A laboratory and a report identifier

    Without both, nothing on the document can be traced back to the laboratory that issued it. The red flag checker lists the rest.

Batch certificates are published as page images in the certificate library. The source PDFs are never served: a certificate is the most forgeable document a supplier publishes, and an editable copy carrying an accredited laboratory's letterhead is worth more to a counterfeiter than to a customer.

PE 22-28 storage and stability

Handling as the product record states it, followed by the degradation chemistry this particular sequence is and is not exposed to.

Handling

Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.

What degrades this compound

Each of these follows from the molecule itself rather than from general peptide handling.

  • Oxidation

    1 Trp

    These side chains oxidise on contact with dissolved oxygen and with peroxide traces in diluents. Oxidation adds 16 daltons per event, so it shows up on a mass spectrum as a satellite peak above the parent and on a chromatogram as a shoulder ahead of the main peak. Minimise headspace air, and do not use a diluent that has been standing open.

  • Light sensitivity

    1 Trp

    The aromatic side chains that make this compound visible at 280 nm are the same ones that absorb ultraviolet light and photo-oxidise. This is the residue-level reason behind the instruction to store in the dark, and it is why an amber vial is not decoration.

  • Aggregation on freeze-thaw

    GRAVY 0.14, net hydrophobic

    A positive grand average of hydropathy means the side chains are on balance hydrophobic, and hydrophobic peptides associate as they concentrate at an advancing ice front. That is the mechanism behind the freeze-thaw warning: each cycle concentrates the solute before it dilutes it again, and aggregates that form do not always redissolve.

What holds up

The degradation routes this compound is not exposed to, which is as specific a fact as the ones it is.

  • No deamidation site

    no Asn or Gln in the sequence

    Deamidation is the slow clock on most reconstituted peptides, and it needs an asparagine or a glutamine to run. This sequence has neither, so time in solution does not convert it to a one-dalton-heavier, more acidic relative.

  • Solubility window

    calculated pI 11.1, net charge 1 at pH 7

    A peptide is least soluble within about a pH unit of its isoelectric point, where it carries no net charge. This one is far enough from neutral that it holds a real charge in an ordinary diluent, which is what keeps it dissolved.

Derived from the primary sequence GVSWGLR, calculated isoelectric point 11.09, GRAVY 0.143. Check the arithmetic with the peptide property calculator and the freeze-thaw estimator.

PE 22-28 compared with Cerebrolysin and Pinealon

Pharmacological class, half-life, evidence grade, competition status and cost per milligram, side by side.

CompoundClassHalf-lifeEvidenceWADACheapest per mg
PE-22-28this pageNootropic / NeuroprotectiveImproved over spadin in rodent work; not established in humansDPreclinical OnlyNot listed$5.4010mg vial, out of stock
CerebrolysinNootropic / NeuroprotectiveNot meaningfully defined for a multi-component preparationCPhase I–II Clinical TrialsNot listed$0.8260mg vial, out of stock
PinealonNootropic / NeuroprotectiveNot establishedDPreclinical / Uncontrolled Russian StudiesNot listed$7.1010mg vial, out of stock
SemaxNootropic / Neuroprotective~3–5 minutes; intranasal extends effective durationDPreclinicalNot listed$2.8010mg vial, out of stock
AdamaxCognitive / Nootropic~4-6 hours (estimated, extended by adamantane)DAnimal/Preclinical OnlyNot listed$8.4010mg vial, out of stock

Evidence grades and half-lives are as recorded in the compound database, which cites its own sources on each compound page. Per-milligram prices are the cheapest strength each compound is currently listed at, in US dollars, and an out-of-stock note means that figure is not purchasable today. Cross-trial comparisons of efficacy are not comparisons: no head-to-head trial exists for most of these pairs.

PE 22-28 in Canada

Price in Canadian dollars, where the parcel ships from, and how long it takes.

Price in CAD

CA$77

The figure charged, not a converted estimate

Ships from

British Columbia

A domestic parcel, so no import clearance step

Transit

2 to 5 business days

After 1 to 2 business days of handling

Free standard shipping

Over CA$250

A bar set for this market, not converted from the US one

PE 22-28 10mg ships from British Columbia to Canadian addresses, so the parcel never crosses a border. That removes the failure a Canadian buyer of research peptides is usually weighing: an inbound international shipment can be held for import clearance or seized, and a domestic one has no clearance step to be held at.

Shipping is quoted live against the delivery address at checkout rather than estimated here, and both the standard and express tiers show their price and transit window before a payment method is chosen. The figure the page shows is the figure the rail charges: all three settlement rails price shipping through the same functions the quote does.

The Canadian figure above is not a loose conversion. Each product's US dollar base is chosen so that the live conversion lands on the Canadian shelf price set for this market, and the result is pushed up to a whole dollar rather than left carrying cents, so one figure serves the page, the feed and every payment rail. See the shipping policy for carriers and cut-off times, and the legal position on research peptides in Canada for the regulatory picture.

What is PE 22-28?

PE 22-28 is a seven-residue peptide, Gly-Val-Ser-Trp-Gly-Leu-Arg, taken from the middle of a 44-amino-acid propeptide that is released when the sorting receptor sortilin, also called neurotensin receptor 3, is matured by the protease furin in the Golgi. The name is literal. The group that studies this family abbreviates that propeptide as PE, and this fragment spans its residues 22 to 28. A longer fragment of the same propeptide, residues 12 to 28, is spadin.

The compound exists because of a potassium channel. TREK-1, the product of the KCNK2 gene and also written K2P2.1, is a two-pore-domain background channel that sits open at rest and holds neurons near their resting potential. In 2006 a laboratory at the Institut de Pharmacologie Moleculaire et Cellulaire in Valbonne, outside Nice, reported that mice lacking Kcnk2 were resistant to depression-like behaviour in five separate models, showed more efficient serotonergic neurotransmission, and mounted a substantially smaller corticosterone rise under stress. Untreated knockout animals behaved like normal animals given fluoxetine. That result turned a background channel into a drug target, and the search for a blocker produced spadin in 2010 and PE 22-28 in 2017.

What makes the target unusual is that it has nothing to do with monoamine reuptake. Fluoxetine does block TREK-1, but with a half-maximal inhibitory concentration near 6 micromolar; PE 22-28 blocks the same channel at 0.10 nanomolar. The literature on PE 22-28 is small, entirely preclinical, and comes almost exclusively from the Valbonne laboratory. There is no registered clinical trial for PE 22-28 or for spadin, and no published pharmacokinetic study in any species.

PE 22-28 Mechanism of Action

PE 22-28 blocks TREK-1, and the block is state dependent. In whole-cell patch clamp on a HEK293 line stably expressing human TREK-1, the current is first opened with 10 micromolar arachidonic acid, then the peptide is applied. Under those conditions 100 nanomolar PE 22-28 reduced current density at 0 mV by 55.5 plus or minus 4.6 percent (n = 13, p < 0.0001), against 44.4 plus or minus 8.8 percent for spadin (n = 7). Full concentration-response curves gave an IC50 of 0.10 nanomolar for PE 22-28 and 0.12 nanomolar for its alanine-substituted analogue, against 40 to 60 nanomolar for spadin: a gain of more than 300-fold from a peptide less than half the length. Inhibition is much weaker when the channel has not been opened first, which the authors read as the peptide needing an open-state conformation to reach the selectivity filter.

Losing a background potassium conductance depolarises the cell. The downstream consequences were mapped mostly on spadin, and they connect the channel to serotonin without touching a transporter. In vivo electrophysiology showed spadin raising the firing rate of dorsal raphe serotonergic neurons by 113 percent, an increase abolished by electrolytic lesion of the medial prefrontal cortex and occluded by the mGluR2/3 antagonist LY 341495. The effect therefore depends on prefrontal TREK-1 channels coupled to mGluR2/3 receptors, and it is additive with, rather than downstream of, 5-HT4 receptor stimulation.

The plasticity arm runs on a faster clock than monoaminergic drugs. A four-day course of PE 22-28 in mice roughly doubled BrdU-positive cell counts in the hippocampus, and in cultured mouse cortical neurons 0.1 micromolar PE 22-28 raised the postsynaptic scaffold protein PSD-95 about twofold between 5 and 36 hours. Work on spadin traced this to MAPK and PI3K signalling and to a rapid rise in hippocampal BDNF, explicitly not through mTOR, which is the route ketamine uses. That distinction matters: two fast-acting mechanisms, two different intracellular pathways.

  1. Propeptide release

    Furin cleaves the sortilin precursor in the Golgi, freeing a 44-residue propeptide (PE) that reaches the circulation and can be measured in mouse and human serum.

  2. Fragment identification

    Spadin (PE 12-28) is degraded by serum metalloproteases within roughly 30 minutes at 37 degrees Celsius. HPLC and mass spectrometry of that degradation gave PE 14-25 and PE 12-27, and the seven-residue PE 22-28 was designed from that ladder.

  3. Open-channel block

    With human TREK-1 first activated by 10 micromolar arachidonic acid, PE 22-28 inhibits the current with an IC50 of 0.10 nanomolar, without touching TREK-2, TRAAK, TRESK, TASK-1 or hERG.

  4. Membrane depolarisation

    Removing a leak potassium conductance shifts the neuron away from its resting potential and raises excitability, the opposite of what TREK-1 activators such as riluzole or polyunsaturated fatty acids do.

  5. Serotonergic disinhibition

    Acting on medial prefrontal cortex TREK-1 channels coupled to mGluR2/3 receptors, spadin increased dorsal raphe 5-HT neuron firing by 113 percent, an effect abolished by prefrontal lesion.

  6. Neurogenesis and synaptogenesis

    Four days of treatment raised hippocampal BrdU-positive cells from 899 plus or minus 109 to 1736 plus or minus 126 per hippocampus in mice, and PSD-95 doubled in cortical neurons exposed to 0.1 micromolar peptide for 36 hours.

PE 22-28 Key Benefits

Every entry below is an observation from a named preclinical model. No human data exists on this compound.

Sub-nanomolar block of human TREK-1

Concentration-response curves on a stable human TREK-1 HEK293 line put the IC50 at 0.10 nM, against 40 to 60 nM for the parent peptide spadin and roughly 6 micromolar for fluoxetine on the same channel. The peptide is more potent than its parent despite being 10 residues shorter.

In vitro

Selective within the two-pore-domain family

At 100 nM in transfected HEK293 cells, PE 22-28 produced no change in currents from human TREK-2 or TRAAK, both pre-activated with arachidonic acid, nor from TRESK or TASK-1. TREK-1 and TREK-2 share 63 percent sequence identity, so the discrimination is finer than family membership would predict.

In vitro

No effect on the cardiac hERG current

Tested at 10 micromolar, one hundred thousand times its IC50 at TREK-1, PE 22-28 and its two retained analogues left the hERG-generated IKr unchanged in both pulse and tail currents. IKr is the principal repolarising current of the ventricle and the usual source of QT liability in psychoactive drug candidates.

In vitro

Reduced immobility in the forced swim test after a single injection

Thirty minutes after one intraperitoneal injection at 3.0 micrograms per kilogram, immobility time in C57Bl/6J mice was 91.8 plus or minus 6.1 seconds against 161.7 plus or minus 6.5 seconds for saline (n = 10 per group, p < 0.0001). Spadin reached a comparable figure only at 100 micrograms per kilogram.

Rodent model

Activity held across three behavioural paradigms and a chemically induced model

A four-day course at 3.0 micrograms per kilogram shortened escape latencies in the learned helplessness test, cut latency to feed in the novelty-suppressed feeding test from 226.1 plus or minus 35.0 to 153.2 plus or minus 5.4 seconds, and held its forced swim effect in mice made depressive by seven weeks of corticosterone.

Rodent model

Hippocampal neurogenesis within four days

BrdU-positive cells per hippocampus rose from 899 plus or minus 109 in saline-injected mice to 1736 plus or minus 126 after four daily intraperitoneal injections (n = 5 per group, p < 0.0001). Classical monoaminergic agents raise this marker only after two to four weeks.

Rodent model

Synaptic scaffold protein increase in cortical neurons

Mouse cortical neurons exposed to 0.1 micromolar PE 22-28 showed a small dip in PSD-95 over the first 5 hours, then a continuous rise to roughly double that level by 36 hours on Western blot. PSD-95 marks mature excitatory synapses, so the newly generated cells appear to become functional rather than merely to divide.

In vitro

Retained activity by oral gavage in mice

The forced swim effect was reproduced when the peptide was given by gavage at 1.0 milligram per kilogram over four days instead of by injection, which is uncommon for an unmodified seven-residue peptide and was one reason the shortened series was pursued.

Rodent model

PE 22-28 Molecular Information

SequenceGly-Val-Ser-Trp-Gly-Leu-Arg (GVSWGLR)
Molecular FormulaC35H55N11O9 (free base)
Molecular Weight773.89 g/mol average, 773.42 Da monoisotopic
CAS Number1801959-12-5
PubChem CID165437303
Amino Acid Count7
Known Synonymsmini-spadin, PE22-28, shortened spadin analogue PE 22-28
Parent PeptideSpadin, PE 12-28, APLPRWSGPIGVSWGLR, 17 residues, C87H133N25O20, about 1849 g/mol
Precursor Protein44-residue sortilin / neurotensin receptor 3 propeptide, residues 34 to 77 of UniProt Q99523, sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR
Position Within SpadinResidues 11 to 17 of the 17-residue spadin sequence, that is, its C-terminal seven residues
Molecular TargetTREK-1 potassium channel, gene KCNK2, also written K2P2.1 or TWIK-related K+ channel 1
Reported PotencyIC50 0.10 nM against arachidonic-acid-activated human TREK-1 in HEK293 whole-cell patch clamp
Net Charge at pH 7+1, from one arginine side chain and the free N-terminal amine against one C-terminal carboxylate
ChromophoreOne tryptophan, no tyrosine and no cysteine, so A280 gives a clean concentration read and no disulfide scrambling is possible
AppearanceWhite to off-white lyophilized powder
Common Salt FormsAcetate and trifluoroacetate

How PE 22-28 Was Identified

The starting problem was durability, not potency. Spadin worked in mice but its behavioural effect was gone beyond seven hours after a single injection, and an earlier attempt to fix that with retro-inverso analogues produced two peptides that extended the effect to about 16 hours but showed in vitro toxicity at higher concentrations and cost too much to synthesise. So the group went the other way and asked what the body was already doing to spadin.

Incubating spadin with mouse serum at 37 degrees Celsius and running the products on reversed-phase HPLC showed almost all of the parent peptide gone by 30 minutes, replaced by two peaks that mass spectrometry identified as PE 14-25 and PE 12-27. Those two, plus three peptides designed around them, were screened at 100 nanomolar against arachidonic-acid-activated human TREK-1. The ladder is informative. PE 14-25 did nothing at all, at 114.7 plus or minus 10.6 percent of the arachidonic acid current (n = 8, p = 0.09). PE 12-27 blocked 28.4 plus or minus 9.9 percent. PE 22-27 gave 25.7 plus or minus 20.0 percent and did not reach significance, PE 22-25 gave 36.0 plus or minus 17.5 percent at p = 0.06, and only PE 22-28 blocked cleanly, at 55.5 plus or minus 4.6 percent.

Two structure-activity conclusions fall out of that screen. Removing the single C-terminal arginine, which is the only difference between PE 22-28 and PE 22-27, destroys the activity. And the seven-residue window is genuinely minimal: shorten it at either end and the block goes. The group then built 16 analogues on PE 22-28 as a core. Most N-terminal additions killed it, including stearic acid at 5.4 percent block, the Fmoc group at 5.8 percent and 5-FAM at 6.6 percent. Only three peptides survived the combined electrophysiology and behavioural filter: PE 22-28 itself, its glycine-to-alanine variant at position 22, and the biotinylated form of that variant.

Why TREK-1 Became an Antidepressant Target

The 2006 knockout paper is the reason this compound class exists. Deleting Kcnk2 in mice produced resistance to depression-like behaviour across five separate models, increased the efficacy of serotonergic neurotransmission, and substantially blunted the corticosterone rise under stress. The knockouts behaved like naive animals treated with fluoxetine, without any drug. That is an unusual result for a background potassium channel, which had until then been studied mostly in the contexts of anaesthesia, pain and ischaemia.

The human evidence for the target is genetic rather than pharmacological, and it is more interesting than most summaries suggest. In the STAR*D effectiveness cohort, variants in KCNK2 showed no association with remission on first-step citalopram among 1554 genotyped participants, but among the 751 who went on to next-step treatment they were associated with response at a Bonferroni-corrected gene-based empirical p below 0.001, with a similar effect size again at the third step. The signal is specific to treatment resistance, not to depression itself. Separately, an fMRI study in 31 healthy volunteers found that the three TREK1 genotypes previously linked to positive antidepressant response were associated with potentiated basal ganglia responses to monetary gains, with no effect on responses to losses.

None of that is evidence for PE 22-28. It is evidence that the channel it blocks is doing something in humans, which is a different and weaker claim, and the two are worth separating when reading anything written about this peptide.

PE 22-28 Compared With Spadin

Spadin is 17 residues, APLPRWSGPIGVSWGLR, and weighs about 1849 g/mol. PE 22-28 is its C-terminal seven residues, GVSWGLR, at 773.89 g/mol. On the channel, the shorter peptide is more than 300 times more potent: 0.10 nanomolar against 40 to 60 nanomolar. In behaviour the ratio holds up. A comparable reduction in forced swim immobility needed 100 micrograms per kilogram of spadin against 3.0 micrograms per kilogram of PE 22-28, and in the corticosterone model PE 22-28 at 3.0 micrograms per kilogram slightly outperformed spadin at 100 micrograms per kilogram, at 98.1 plus or minus 8.8 seconds against 117.4 plus or minus 6.9 seconds, with a control value of 164.9 plus or minus 6.0 seconds.

Duration is where the record needs a caveat that is almost never stated. Spadin has a measured half-effect time of about 6 hours in the forced swim test. The 14 to 23 hour figures widely attributed to PE 22-28 come from a time-course experiment run on the two derivatives, not on the plain peptide. G/A-PE 22-28 gave 14 hours at 3.2 micrograms per kilogram and 21 hours at 32 micrograms per kilogram, and the biotinylated variant gave 17 and 23 hours at 4.0 and 40 micrograms per kilogram. PE 22-28 itself was not in that time course, and its own action duration has not been published.

The two peptides also carry different safety evidence. The wider panel showing no change in cardiac rate or systolic pressure, no worsening of kainate-induced seizures, no increase in infarct size after focal ischaemia and no change in glycaemia was run on spadin in 2012. For PE 22-28 the record is narrower: four other two-pore-domain channels and hERG.

PE 22-28 Selectivity and the Channels It Does Not Touch

Selectivity is the strongest part of this compound's in vitro file. Native HEK293 cells were transfected with human TREK-2, TRAAK, TRESK and TASK-1. TREK-2 and TRAAK were opened with 10 micromolar arachidonic acid, then 100 nanomolar PE 22-28 was applied at peak current. No change in amplitude was seen in any of the four. TREK-1 and TREK-2 share 63 percent identity and TREK-1 and TRAAK 45 percent, so discriminating between them at a hundredfold above the TREK-1 IC50 is a meaningful result rather than a formality.

The hERG test was run at 10 micromolar, five orders of magnitude above the working concentration at TREK-1, and left both the end-of-pulse and tail current densities unchanged. That matters because drug-induced block of IKr is the standard mechanism behind QT prolongation and torsades de pointes, and it is a recurring liability in psychoactive drug development.

TREK-1 itself, however, is expressed well outside the brain: in cardiac tissue, vascular smooth muscle, the gastrointestinal tract, adipocytes, chondrocytes and pancreatic beta cells. A clean hERG result says nothing about what blocking TREK-1 in those tissues would do. Recent work has implicated TREK-1 in adipocyte differentiation, in NLRP3 inflammasome activity in macrophages, in alveolar epithelial injury and in astrocytic potassium handling, so this is not a brain-specific target, and the consequences of blocking it elsewhere have not been characterised for this peptide.

PE 22-28 in Rodent Behavioural Models

Four paradigms carry the behavioural case, all in male C57Bl/6J mice aged 7 to 9 weeks, with 10 animals per group. In the Porsolt forced swim test, a single intraperitoneal injection of 3.0 micrograms per kilogram cut immobility over the final 4 minutes of a 6-minute session to 91.8 plus or minus 6.1 seconds from a saline value of 161.7 plus or minus 6.5 seconds. In the learned helplessness test, four days of the same amount shortened escape latencies across 30 trials following a four-day inescapable shock training session. In the novelty-suppressed feeding test, four days of treatment cut the latency to start eating in a brightly lit open arena to 153.2 plus or minus 5.4 seconds from 226.1 plus or minus 35.0 seconds.

The fourth is a chemically induced model rather than an acute screen. Seven weeks of corticosterone produces a depressive-like state in mice, and both acute and four-day PE 22-28 reversed the forced swim and novelty-suppressed feeding readouts in those animals. That is a more demanding test than the acute paradigms, because the animals start from an altered baseline.

The honest framing is that these are screening assays. Reduced immobility in a forced swim test is produced by many compounds, including psychostimulants that nobody would call antidepressants, and a single behavioural readout cannot separate an antidepressant-like effect from increased locomotion. What raises the interest here is convergence: the same 3.0 micrograms per kilogram that shifts these behaviours also produces the neurogenesis and synaptic markers on the same four-day clock, and the compound has a defined molecular target with an IC50 measured on cloned human channels.

PE 22-28 Neurogenesis and Synaptogenesis Findings

The neurogenesis experiment used BrdU incorporation across the whole hippocampus, with eight 40-micrometre vibratome sections from bregma 3.3 to 5.3 counted per animal. After four daily intraperitoneal injections at 3.0 to 4.0 micrograms per kilogram, counts were 1736 plus or minus 126 for PE 22-28, 2110 plus or minus 132 for its glycine-to-alanine variant and 1809 plus or minus 267 for the biotinylated variant, against 899 plus or minus 109 for saline, with n = 5 per group. The four-day timeframe is the point of the experiment. Chronic monoaminergic treatment raises this marker only after two to four weeks, and that lag is one of the standing explanations for why those drugs take weeks to work.

Synaptogenesis was read as PSD-95 abundance by Western blot in primary mouse cortical neurons at 0.1 micromolar peptide. Levels dipped slightly over the first 5 hours, then rose continuously, ending roughly twice as high at 36 hours. Taken with the neurogenesis counts, the interpretation offered is that most of the newly born cells go on to mature rather than being pruned.

The mechanistic detail behind this came from the parent peptide. Spadin activates MAPK and PI3K in cultured neurons in a time and concentration dependent way, and the PI3K arm accounts for its protection against staurosporine-induced apoptosis. It raises both mRNA and protein for PSD-95 and synapsin, increases the proportion of mature dendritic spines in cortical neurons, and produces a rapid rise in hippocampal BDNF after injection. Critically for the comparison people want to make, spadin does not go through mTOR, which is the pathway that carries ketamine's rapid effect. Two fast-acting mechanisms, two different routes.

PE 22-28 Beyond Depression Models

The 2019 stroke study is the most complicated result in this literature and the one that most changes how the peptide should be read. Working in a mouse model of focal ischaemia with post-stroke depression, the group found that the peptide, which they call mini-spadin in that paper, acts biphasically on TREK-1: at low concentrations it increases channel activity, and only at higher concentrations does it inhibit. They exploited that directly. A single low amount, 0.03 micrograms per kilogram given intraperitoneally 30 minutes after ischaemia onset and then once daily for seven days, was used to activate the channel and produce neuroprotection. The peptide was then given at 3 micrograms per kilogram, once daily four days a week, to block it and produce the antidepressant-like effect. Across that protocol the animals limited the loss of body weight, showed less delayed dopaminergic degeneration in the substantia nigra, improved on motor and cognitive tests, and showed reduced forced swim and novelty-suppressed feeding signals, with enhanced neurogenesis and synaptogenesis alongside.

A biphasic concentration response means the direction of the effect at this target depends on concentration, which is not a property that survives casual translation between species, routes or timeframes. It is the single most important qualification on everything else written about the compound.

A second line of work sits outside the nervous system. TREK-1 is expressed in pancreatic beta cells, and the sortilin propeptide stimulates insulin secretion only in the presence of glucose. In 2021 the same laboratory reported that the propeptide, spadin and mini-spadin all protected beta cells against interleukin-1-beta-induced death by raising intracellular calcium through membrane depolarisation, working through the calmodulin kinase pathway and phosphorylation of CREB, with mini-spadin additionally promoting beta-cell proliferation. The unifying mechanism, depolarisation through loss of a background potassium current, is the same one that operates in neurons.

PE 22-28 Handling, Stability and Analytical Characterisation

The composition dictates the handling. GVSWGLR contains no cysteine, so disulfide scrambling is not a failure mode, and no methionine, so the classic oxidation liability is absent. It does contain a single tryptophan, which is the residue most vulnerable to photo-oxidation in a short chain and the reason amber vials and dark storage are not decorative. That same tryptophan is analytically useful. With no tyrosine in the sequence, absorbance at 280 nanometres reports on one residue only and gives a clean concentration check independent of gravimetric mass.

Proteolytic stability was the original design problem. The parent 17-mer was almost entirely gone from mouse serum within 30 minutes at 37 degrees Celsius, and the degradation was traced to metalloproteases using 1,10-phenanthroline as an inhibitor. Shortening the peptide was the response to that, though the shortened form still has a short in vitro serum half-life. What improved was the duration of the functional effect, not the resistance of the molecule in a tube.

Two termini decide whether a batch is the right molecule. Removing the C-terminal arginine, giving PE 22-27, abolishes channel block. Adding bulk to the N-terminal glycine abolishes it in most cases: stearic acid, the Fmoc group, 5-FAM, myristoyl and palmitoyl derivatives all fell below significance, while biotin, dansyl and a glycine-to-alanine substitution were tolerated. A certificate of analysis that reports purity by area percent without confirming the intact mass therefore leaves the pharmacologically decisive part of the molecule unverified. Reversed-phase C18 HPLC with an acetonitrile gradient from 20 to 70 percent is the separation used in the source work, and mass spectrometry is what distinguished the degradation fragments in the first place.

One practical note on labelling. Peptides of this class are supplied as an acetate or trifluoroacetate salt, so the gravimetric contents of a vial exceed the free-base peptide content. Net peptide content belongs on the analysis, not inferred from the label.

What the PE 22-28 Literature Does Not Establish

There is no human data of any kind. A search of ClinicalTrials.gov for spadin and for PE 22-28 returns no registered studies, and neither the parent peptide nor any shortened analogue has entered a Phase 1 trial in the two decades since the target was proposed.

There is also no pharmacokinetics. No plasma concentration, no measured half-life, no clearance figure and no brain penetration measurement has been published for PE 22-28 in any species. The 14 to 23 hour numbers in circulation are behavioural half-effect times for two derivatives, and a behavioural duration is not a pharmacokinetic parameter. Whether the peptide crosses the blood-brain barrier intact, or acts through a peripheral route, is unresolved. The group synthesised biotinylated variants precisely because biotinylation has been reported to improve peptide brain uptake, which implies uptake was a live question.

The evidence base is narrow in the way that matters most. TREK-1 as a channel and spadin as a tool compound have been taken up by other laboratories, including a 2020 Korean study that used spadin to establish that TWIK-1/TREK-1 heterodimers carry astrocytic passive conductance. PE 22-28 specifically appears almost only in publications from the Valbonne group and its collaborators. The key neurogenesis result rests on five animals per group and the behavioural work on ten. There is no published toxicology, no repeat-exposure study, no genotoxicity or reproductive data, and the off-target screen covered four related potassium channels plus hERG rather than a broad panel.

One further gap is specific to how this compound gets described in product catalogues. Because it is short and potent, and because the parent peptide carries a much larger body of work, findings from spadin are routinely attributed to PE 22-28 without the substitution being flagged. The serotonergic electrophysiology, the BDNF and mTOR mechanism, the cardiac and seizure panel, and the effect on 5-HT firing rate were all measured on spadin. Whether they hold for the seven-residue fragment is a reasonable inference and not a finding.

PE 22-28 FAQ

PE 22-28 Research Summary

PE 22-28, also called mini-spadin, is the seven-residue peptide GVSWGLR, cut from residues 22 to 28 of the 44-amino-acid propeptide released when sortilin is matured by furin. It blocks the TREK-1 background potassium channel with an IC50 of 0.10 nanomolar on cloned human channels, more than 300 times more potently than its 17-residue parent spadin, without touching TREK-2, TRAAK, TRESK, TASK-1 or hERG. The mechanism is distinct from monoamine reuptake inhibition, which is the reason the compound is of interest at all.

In C57Bl/6J mice, a single intraperitoneal injection at 3.0 micrograms per kilogram reduced forced swim immobility from 161.7 to 91.8 seconds, and a four-day course shortened learned helplessness escape latencies, cut novelty-suppressed feeding latency, held its effect in corticosterone-treated animals, roughly doubled hippocampal BrdU-positive cells, and about doubled PSD-95 in cultured cortical neurons by 36 hours. The four-day clock is the recurring theme, against the three to four weeks that monoaminergic agents need for the equivalent markers.

The counterweight is the size and provenance of the evidence. Everything published is preclinical, almost all of it comes from one laboratory in Valbonne, the neurogenesis result rests on five animals per group, no pharmacokinetic study exists in any species, no toxicology has been published, and the peptide behaves biphasically on its own target, activating TREK-1 at low concentrations and blocking it at higher ones. A good deal of what is written about PE 22-28 elsewhere is spadin data attributed to the fragment without the substitution being noted.

Scientific References

Primary literature and public trial registries only. No supplier or retailer pages are cited.

  1. 1Shortened spadin analogs display better TREK-1 inhibition, in vivo stability and antidepressant activityDjillani A, Pietri M, Moreno S, Heurteaux C, Mazella J, Borsotto M · Frontiers in Pharmacology · 2017
  2. 2Spadin, a sortilin-derived peptide, targeting rodent TREK-1 channels: a new concept in the antidepressant drug designMazella J, Petrault O, Lucas G, et al. · PLoS Biology · 2010
  3. 3Deletion of the background potassium channel TREK-1 results in a depression-resistant phenotypeHeurteaux C, Lucas G, Guy N, et al. · Nature Neuroscience · 2006
  4. 4In vitro and in vivo regulation of synaptogenesis by the novel antidepressant spadinDevader C, Khayachi A, Veyssiere J, et al. · British Journal of Pharmacology · 2015
  5. 5Spadin as a new antidepressant: absence of TREK-1-related side effectsMoha Ou Maati H, Veyssiere J, Labbal F, et al. · Neuropharmacology · 2012
  6. 6Retroinverso analogs of spadin display increased antidepressant effectsVeyssiere J, Moha Ou Maati H, Mazella J, et al. · Psychopharmacology · 2015
  7. 7First evidence of protective effects on stroke recovery and post-stroke depression induced by sortilin-derived peptidesPietri M, Djillani A, Mazella J, Borsotto M, Heurteaux C · Neuropharmacology · 2019
  8. 8Fighting against depression with TREK-1 blockers: past and future. A focus on spadinDjillani A, Pietri M, Mazella J, Heurteaux C, Borsotto M · Pharmacology and Therapeutics · 2019
  9. 9Role of TREK-1 in health and disease, focus on the central nervous systemDjillani A, Mazella J, Heurteaux C, Borsotto M · Frontiers in Pharmacology · 2019
  10. 10The involvement of sortilin/NTSR3 in depression as the progenitor of spadin and its role in the membrane expression of TREK-1Mazella J, Borsotto M, Heurteaux C · Frontiers in Pharmacology · 2018
  11. 11Pharmacogenetic analysis of genes implicated in rodent models of antidepressant response: association of TREK1 and treatment resistance in the STAR*D studyPerlis RH, Moorjani P, Fagerness J, et al. · Neuropsychopharmacology · 2008
  12. 12Variation in TREK1 gene linked to depression-resistant phenotype is associated with potentiated neural responses to rewards in humansDillon DG, Bogdan R, Fagerness J, et al. · Human Brain Mapping · 2010
  13. 13The peptidic antidepressant spadin interacts with prefrontal 5-HT4 and mGluR2 receptors in the control of serotonergic functionMoha ou Maati H, Bourcier-Lucas C, Veyssiere J, et al. · Brain Structure and Function · 2016
  14. 14Sortilin-derived peptides promote pancreatic beta-cell survival through CREB signaling pathwayDaziano G, Blondeau N, Beraud-Dufour S, et al. · Pharmacological Research · 2021
  15. 15Targeting two-pore domain K+ channels TREK-1 and TASK-3 for the treatment of depression: a new therapeutic conceptBorsotto M, Veyssiere J, Moha Ou Maati H, et al. · British Journal of Pharmacology · 2015
  16. 16A human TREK-1/HEK cell line: a highly efficient screening tool for drug development in neurological diseasesMoha ou Maati H, Peyronnet R, Devader C, et al. · PLoS ONE · 2011
  17. 17Spadin modulates astrocytic passive conductance via inhibition of TWIK-1/TREK-1 heterodimeric channelsBae Y, Choi JH, Ryoo K, et al. · International Journal of Molecular Sciences · 2020
  18. 18PE 22-28, compound summary, CID 165437303PubChem · National Library of Medicine · 2026
  19. 19Sortilin (SORT1), Homo sapiens, entry Q99523: signal peptide and 44-residue propeptide annotationUniProt Consortium · UniProtKB · 2026

Disclaimer

All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are furnished for in-vitro studies only. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease.

PE 22-28 10mg: frequently asked questions

Answered from the product record and the certificate file. Volta does not answer questions about administration, dosing or protocols.

What is supplied in a 10 mg vial of PE 22-28?

A sealed single-use vial containing 10 mg of PE 22-28 as a lyophilized powder. Soluble in bacteriostatic water. No diluent, syringe or other supply is included.

Is PE 22-28 supplied for human use?

No. For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Volta does not provide dosing, administration or protocol guidance for any material listed.

What purity is this PE 22-28 released to?

>99% by HPLC. That figure is a release specification, a threshold Volta sets for every batch, and it is not the same kind of statement as a purity measured by a named laboratory for a named lot.

Is there a certificate of analysis for this PE 22-28 vial?

A batch-specific Certificate of Analysis is available for this product on request. It is not published on the site yet: the batch history on the quality page lists the certificates already published, and this vial is covered by the release specification until its own is added there.

How should PE 22-28 be stored before reconstitution?

Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.

Where does this ship from?

British Columbia, Canada. Canadian orders are domestic, so they clear no customs and pay no import duty. International orders ship from the same facility.

More from the research catalogue

Every compound below has its own specification, batch number and certificate page, whether or not a vial is in stock today. Supplied for laboratory research use only.

Related research compounds

Browse all wellness peptides

Your Cart

Your cart is empty

Browse our catalog to add research compounds.