
IGF-1 LR3 1mg Peptide
For in-vitro laboratory research only. Not for human or animal administration.
Batch #: VPIG1100
Get Notified When Available
This product is currently out of stock. Enter your email and we'll notify you the moment it's back.
Research Use Only
For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Batch-specific Certificates of Analysis available for all products.
IGF-1 LR3 1mg: overview
What the vial contains and what the material is, stated as specifications rather than as outcomes.
IGF-1 LR3 supplied as a lyophilized powder in a sealed single-use vial containing 1 mg of material. IGF-1 LR3: molecular weight 9,111 g/mol (9.1 kDa). Released to a specification of >99% purity by HPLC. Soluble in bacteriostatic water. Supplied for in-vitro laboratory research only. Not a drug, food or supplement. Not for human or veterinary use.
Volta does not provide dosing, administration or protocol guidance for any material listed.
IGF-1 LR3 1mg specifications
Every field the product record holds. A field with no value is omitted rather than printed as a dash.
- Fill
- 1mg
- Form
- Lyophilized powder
- Molecular weight
- 9,111 g/mol (9.1 kDa)
- Solubility
- Soluble in bacteriostatic water
- Shelf life
- 24 months from date of manufacture
IGF-1 LR3 analytical verification and batch documentation
What the purity figure on this page is, who measured what, and which of the two a reader is looking at.
Specification. Every batch is released to >99% purity by HPLC. That is a threshold Volta sets, and it is a promise rather than a measurement.
Measurement. No certificate for this compound is published on the site yet. A batch-specific Certificate of Analysis is available on request, and the batch history lists the ones already published. Until one is published for this material, the figure above is the release specification and nothing on this page is a laboratory result.
Checking a certificate. The batch number printed beside the price is derived from the compound code and the vial strength; the lot number on a certificate is transcribed from the document. They are produced independently, so comparing them is a real check. How to read one is set out in the quality and testing methodology page.
For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease.
Native IGF-1 circulates almost entirely bound to IGFBP-3, which controls its availability and clears it within minutes. The Long R3 analogue is engineered specifically to escape that regulation: the R3 substitution disrupts binding protein affinity while the N-terminal extension further reduces it. The result is a molecule with far greater free fraction and a much longer functional half-life, which is why it is the standard IGF-1 research form in cell culture. It is a recombinant protein rather than a synthetic peptide, so handling requirements are stricter.
- Released to a >99% purity specification by HPLC
- Lyophilized powder, 1mg per vial
- Soluble in bacteriostatic water
- For laboratory research use only
Frequently Bought Together

IGF-1 LR3 1mg
1mg
$69 USD
Bundle & Save
$143 USD
Save $7.15 USD
$192 USD
Save $19.20 USD
$228 USD
Save $34.20 USD
$263 USD
Save $52.60 USD
Click any product above to toggle selection
IGF-1 LR3 1mg: what is in the vial
The arithmetic specific to this 1mg vial, and what a milligram of IGF-1 LR3 costs in each strength the catalogue carries. Concentrations are stated, not recommended.
Vial contents
1 mg
Lyophilised powder, reconstituted by the buyer
Cost of material
$69 / mg USD
CA$99 / mg in Canadian dollars
Concentration at each diluent volume
1 mg of dry material reaches these concentrations in the volumes below. A U-100 syringe marking is 0.01 ml by definition, so the last column is a unit conversion at each concentration rather than a quantity to use.
| Diluent added | Concentration | In 0.1 ml | Per U-100 unit |
|---|---|---|---|
| 1 ml | 1 mg/ml | 100 mcg | 10 mcg |
| 2 ml | 500 mcg/ml | 50 mcg | 5 mcg |
| 3 ml | 333 mcg/ml | 33.3 mcg | 3.3 mcg |
| 5 ml | 200 mcg/ml | 20 mcg | 2 mcg |
For a volume this table does not list, the reconstitution calculator takes any vial size and diluent volume.
IGF-1 LR3 purity and identity: how the figure is measured
What >99% (HPLC) means, the masses an identity check has to land on, and the entries that make a certificate of analysis checkable rather than decorative.
Stated purity
>99% (HPLC)
Area percent of the main peak by reversed-phase HPLC
Average mass
9,111 g/mol
The figure an identity check has to land on
Detection
280 nm
A 1 mg/ml solution reads about 0.53 AU in a 1 cm cell
Identity by mass: the ions to expect
An electrospray source protonates the molecule rather than weighing it neutral, so a spectrum shows a series of charge states rather than the molecular weight itself. These are the m/z values 9,111 g/mol produces, and they are what a mass spectrum on a certificate for IGF-1 LR3 has to match.
| Ion | Charge | Expected m/z |
|---|---|---|
| [M+H]+ | 1+ | 9,112.01 |
| [M+2H]2+ | 2+ | 4,556.51 |
| [M+3H]3+ | 3+ | 3,038.01 |
A peptide this size is normally reported at its doubly and triply charged states, and the singly charged ion may not appear at usable intensity at all. A spectrum showing only one of these is not a failed identity check.
Why 280 nm
The sequence carries 3 Tyr, so it absorbs at 280 nm as well as at 214 nm on the peptide bond.
This matters when reading someone else's certificate: a purity figure quoted at 280 nm for a compound with no aromatic residue is measuring an absorbance the molecule does not have.
What a certificate for IGF-1 LR3 should carry
A purity percentage on its own is not checkable. These are the entries that make one verifiable, and their absence is the most common weakness in a research-peptide certificate.
The chromatogram, not only the number
A stated area percent with no trace behind it cannot be read for the shape of the main peak or for what eluted beside it. The HPLC interpreter walks through what a trace shows.
Net peptide content, separately from gross mass
A lyophilised peptide is a salt, usually of trifluoroacetic or acetic acid, plus residual water. The vial's stated milligrams are gross; net peptide content is the fraction of that mass which is the molecule. The two differ by ten to twenty percent routinely, and only one of them is what the price is per milligram of. The net peptide content calculator converts between them.
The counterion, named
Which salt form the powder is in changes the net content and the pH the powder dissolves at. A certificate that never names it leaves both unknowable.
Water content, by a stated method
Loss on drying and Karl Fischer titration give different numbers, and a water figure with no method attached cannot be compared with anyone else's.
A laboratory and a report identifier
Without both, nothing on the document can be traced back to the laboratory that issued it. The red flag checker lists the rest.
Batch certificates are published as page images in the certificate library. The source PDFs are never served: a certificate is the most forgeable document a supplier publishes, and an editable copy carrying an accredited laboratory's letterhead is worth more to a counterfeiter than to a customer.
IGF-1 LR3 storage and stability
Handling as the product record states it, followed by the degradation chemistry this particular sequence is and is not exposed to.
Handling
Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.
What degrades this compound
Each of these follows from the molecule itself rather than from general peptide handling.
Oxidation
3 Met and 6 CysThese side chains oxidise on contact with dissolved oxygen and with peroxide traces in diluents. Oxidation adds 16 daltons per event, so it shows up on a mass spectrum as a satellite peak above the parent and on a chromatogram as a shoulder ahead of the main peak. Minimise headspace air, and do not use a diluent that has been standing open.
Deamidation
2 Asn and 2 GlnAsparagine and glutamine lose their side-chain amide in aqueous solution, becoming aspartate and glutamate. The product is one dalton heavier and one charge more acidic, which moves its retention time without changing its size much, so it reads as an extra peak rather than a smaller one. The fast-deamidating N-G motif sits at position 13, so this compound loses its amide in solution faster than the residue count alone suggests.
Disulfide exchange
6 CysWith two or more cysteines the molecule can form an intramolecular bridge, and in solution it can also exchange with another copy of itself to give a disulfide-linked dimer. A dimer is twice the mass and elutes late, so it is visible on both a chromatogram and a spectrum. Reducing agents such as DTT or TCEP break the bridge and change the molecule, which is fine when it is intended and destroys the sample when it is not.
Light sensitivity
3 TyrThe aromatic side chains that make this compound visible at 280 nm are the same ones that absorb ultraviolet light and photo-oxidise. This is the residue-level reason behind the instruction to store in the dark, and it is why an amber vial is not decoration.
Interfacial and surface loss
9,111 g/mol, above the 3,500 g/mol range where this dominatesA peptide this size unfolds at boundaries. It adsorbs to glass and to polypropylene, and it denatures at the air-water interface that shaking creates, which is why a vial is swirled rather than vortexed and why the diluent is run down the vial wall instead of squirted onto the powder. The failure is quiet: interfacial loss removes material without changing what is left behind, so the solution still assays clean at a concentration lower than the arithmetic says.
What holds up
The degradation routes this compound is not exposed to, which is as specific a fact as the ones it is.
Net hydrophilic
GRAVY -0.07A negative grand average of hydropathy means the side chains are on balance polar, which is the profile that stays in solution rather than associating. Freeze-thaw cycles are still worth avoiding, but this compound is not one of the hydrophobic sequences that aggregate irreversibly at an ice front.
Solubility window
calculated pI 8.2, net charge 2.6 at pH 7A peptide is least soluble within about a pH unit of its isoelectric point, where it carries no net charge. This one is far enough from neutral that it holds a real charge in an ordinary diluent, which is what keeps it dissolved.
Derived from the primary sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA, calculated isoelectric point 8.16, GRAVY -0.066. Check the arithmetic with the peptide property calculator and the freeze-thaw estimator.
IGF-1 LR3 compared with GHRP-2 and GHRP-6
Pharmacological class, half-life, evidence grade, competition status and cost per milligram, side by side.
| Compound | Class | Half-life | Evidence | WADA | Cheapest per mg |
|---|---|---|---|---|---|
| IGF-1 LR3this page | Growth Factor | 20-30 hours | DPreclinical | Prohibited | $691mg vial, out of stock |
| GHRP-2 | Growth Hormone Secretagogue | ~15–60 minutes | CPhase I–II Clinical Trials | Prohibited | $5.605mg vial |
| GHRP-6 | Growth Hormone Secretagogue | ~15–60 minutes | DPreclinical | Prohibited | $6.635mg vial |
| Ipamorelin | Growth Hormone Secretagogue | ~2 hours | DPreclinical | Prohibited | $7.205mg vial |
| Sermorelin | Growth Hormone Secretagogue | ~10–20 minutes | CPhase I–II Clinical Trials | Prohibited | $6.9010mg vial |
Evidence grades and half-lives are as recorded in the compound database, which cites its own sources on each compound page. Per-milligram prices are the cheapest strength each compound is currently listed at, in US dollars, and an out-of-stock note means that figure is not purchasable today. Cross-trial comparisons of efficacy are not comparisons: no head-to-head trial exists for most of these pairs.
IGF-1 LR3 in Canada
Price in Canadian dollars, where the parcel ships from, and how long it takes.
Price in CAD
CA$99
The figure charged, not a converted estimate
Ships from
British Columbia
A domestic parcel, so no import clearance step
Transit
2 to 5 business days
After 1 to 2 business days of handling
Free standard shipping
Over CA$250
A bar set for this market, not converted from the US one
IGF-1 LR3 1mg ships from British Columbia to Canadian addresses, so the parcel never crosses a border. That removes the failure a Canadian buyer of research peptides is usually weighing: an inbound international shipment can be held for import clearance or seized, and a domestic one has no clearance step to be held at.
Shipping is quoted live against the delivery address at checkout rather than estimated here, and both the standard and express tiers show their price and transit window before a payment method is chosen. The figure the page shows is the figure the rail charges: all three settlement rails price shipping through the same functions the quote does.
The Canadian figure above is not a loose conversion. Each product's US dollar base is chosen so that the live conversion lands on the Canadian shelf price set for this market, and the result is pushed up to a whole dollar rather than left carrying cents, so one figure serves the page, the feed and every payment rail. See the shipping policy for carriers and cut-off times, and the legal position on research peptides in Canada for the regulatory picture.
What is IGF-1 LR3?
IGF-1 LR3, written in the primary literature as Long [Arg3]-IGF-I or LongR3-IGF-I, is a recombinant 83-residue analogue of human insulin-like growth factor 1. It differs from the 70-residue mature hormone in exactly two ways: arginine replaces glutamate at position 3 of the IGF-1 sequence, and a 13-residue extension, Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn, is fused to the N-terminus. Both changes were introduced by a group at the CSIRO Division of Human Nutrition and the University of Adelaide and were described in two 1992 papers in the Journal of Molecular Endocrinology.
Neither change was made to improve receptor binding. Both sit in the region of IGF-1 that contacts the six IGF binding proteins, and the analogue was built to fail that contact on purpose. In serum, native IGF-1 is almost entirely locked into a 150 kDa ternary complex with IGFBP-3 and the acid-labile subunit, a reservoir that keeps free ligand concentrations very low. Long [Arg3]-IGF-I largely escapes that reservoir, and every property the compound is known for follows from that single design decision.
The compound's documented working life is in cell culture rather than in animals or people. It is a standard insulin substitute in serum-free Chinese hamster ovary production media, it appears in stem cell differentiation media, and it is the IGF-1 receptor agonist of choice for cultures whose own cells secrete binding proteins into the medium. Long [Arg3]-IGF-I has never entered a registered human clinical trial. The clinical IGF-1 record belongs to mecasermin, which is recombinant native IGF-1, and does not transfer to this analogue.
IGF-1 LR3 Mechanism of Action
The primary target is the type 1 IGF receptor (IGF-1R), a disulfide-linked alpha2beta2 receptor tyrosine kinase. Ligand occupancy of the extracellular alpha subunits drives trans-autophosphorylation of the beta-subunit kinase domain, which then recruits insulin receptor substrate 1 and 2 and the adaptor Shc. Two branches follow. The PI3K/Akt arm raises protein synthesis through mTORC1 and S6K1, suppresses FoxO-driven transcription of the muscle atrophy genes, and phosphorylates Bad to blunt apoptosis. The Ras/Raf/MEK/ERK arm carries the proliferative signal and cell cycle entry.
Receptor selectivity is not absolute, and the analogue does not change that. IGF-1R and the insulin receptor are close relatives that phosphorylate an overlapping substrate set, and in tissues expressing both, half-receptors assemble into IR/IGF-1R hybrids that bind IGF-1 with far higher affinity than they bind insulin. Francis and colleagues tested the Long analogues in H35 rat hepatoma cells, where the IGFs signal through the insulin receptor rather than IGF-1R, and found the analogues held roughly the same potency ratio relative to IGF-1 that they held in L6 myoblasts. Activity is therefore not confined to IGF-1R.
The enhanced potency is a binding protein phenomenon, not a receptor phenomenon, and the primary papers are unambiguous about it. King and colleagues reported that [Arg3]-IGF-I bound very poorly to bovine IGFBP-2 while binding slightly less well than native IGF-1 to the type 1 receptor on L6 myoblasts. Tomas and colleagues put a number on the receptor side: LR3IGF-I binds threefold less well than IGF-1 to the type 1 IGF receptor. What the molecule gains is free fraction, and it pays for that gain with intrinsic receptor affinity.
The experiment that settles the point is a negative control almost no product page mentions. Francis and colleagues ran the analogue series on chicken embryo fibroblasts, a line that secretes no detectable IGF binding proteins into the medium. In that system Long [Arg3]-IGF-I was less potent than native IGF-1. In cell lines that do secrete IGFBPs, the potency order ran Long [Arg3]-IGF-I and des(1-3)IGF-I ahead of Long [Gly3]-IGF-I, ahead of Long IGF-I, ahead of IGF-1. The familiar claim that the analogue is roughly three times more potent is therefore a property of the assay system rather than of the molecule, and it inverts in a binding-protein-free system. For anyone choosing a ligand, that is the operative fact.
Binding protein escape
Arg at position 3 and the hydrophobic N-terminal extension both disrupt the IGFBP contact surface, so the analogue is not sequestered into the IGFBP-3 and acid-labile subunit ternary complex that holds most native IGF-1 out of circulation as free ligand.
IGF-1R occupancy
Free analogue binds the alpha subunits of the alpha2beta2 IGF-1 receptor with roughly threefold lower affinity than native IGF-1, which is more than offset by the much larger free fraction in any medium containing binding proteins.
Kinase activation and substrate docking
Occupancy triggers trans-autophosphorylation of the beta-subunit tyrosine kinase, creating docking sites for IRS-1, IRS-2 and Shc.
PI3K and Akt arm
IRS-bound PI3K generates PIP3, activating Akt, which drives mTORC1 and S6K1 to raise translation initiation, phosphorylates and excludes FoxO transcription factors, and phosphorylates Bad to reduce apoptotic signalling.
Ras and MAPK arm
Shc and Grb2 route the signal through Ras, Raf, MEK and ERK1/2, which carries the proliferative and cell cycle entry component observed in myoblast and fibroblast cultures.
Feedback onto the somatotropic axis
In whole animals the signal feeds back on growth hormone secretion. A four-day infusion in finisher pigs cut mean plasma growth hormone by 23 percent and the area under the growth hormone pulse curve by 60 percent, with plasma IGFBP-3, endogenous IGF-1 and insulin all falling alongside it.
IGF-1 LR3 Key Benefits
Every entry below names the model it was observed in. Long [Arg3]-IGF-I has no human trial record, so nothing here is a human finding.
Escapes IGF binding protein sequestration
The Arg3 substitution and the 13-residue N-terminal extension both sit in the IGFBP contact region. [Arg3]-IGF-I bound very poorly to bovine IGFBP-2 in the original characterisation, and the analogue is not efficiently captured into the IGFBP-3 and acid-labile subunit ternary complex that carries most circulating IGF-1.
MechanisticHigher potency wherever binding proteins are present
In cell lines that secrete IGFBPs into the medium, Long [Arg3]-IGF-I stimulated protein and DNA synthesis and inhibited protein breakdown more strongly than native IGF-1, ranking alongside des(1-3)IGF-I at the top of the analogue series. The advantage disappears and reverses in cultures that secrete no binding proteins.
In vitroReplaces insulin in serum-free CHO production media
Two serum-free CHO lines expressing recombinant cytokine receptors were compared on insulin against LongR3. One line, CL23, required either factor to grow at all, and LongR3 sustained viability of both lines better than insulin under production conditions.
In vitroShifts product quality attributes in industrial CHO culture
In an industrial CHO line producing an Fc-fusion protein, LongR3 supplementation raised volumetric productivity and altered the N-linked glycosylation profile of the product. That places the analogue among the media components that change a biologic's critical quality attributes, not merely its titre.
In vitroSubstitutes for insulin in stem cell differentiation media
Replacing insulin with LongR3-IGF-1 permitted embryonic stem cells to differentiate into neuroprogenitors and into insulin-secreting cells, a protocol change that also removes the ambiguity of adding insulin to a culture whose readout is insulin secretion.
In vitroReverses glucocorticoid-driven protein loss in rats
In 150 g male rats made catabolic with 20 micrograms of dexamethasone daily, seven days of IGF-1 by implanted osmotic minipump gave a 6 g body weight gain against a 19 g loss in the dexamethasone-only group. LR3IGF-I and des(1-3)IGF-I were about 2.5-fold more potent than IGF-1 in the same design, and 3-methylhistidine excretion, a marker of myofibrillar protein breakdown, fell from 83.5 to 65.1 micromol per kg over seven days at the top IGF-1 dose.
Rodent modelMarked trophic effect on gut in the same rat model
The gut proved the most sensitive target tissue. IGF-1 raised total gut weight by up to 60 percent in dexamethasone-treated rats, with effects in stomach, small intestine and colon, and histology showed increased cross-sectional mass rather than increased length. Both low-IGFBP-affinity analogues were severalfold more potent than IGF-1.
Rodent modelOrgan-specific growth without increased nutrient transfer in fetal sheep
A one-week LR3 IGF-1 infusion into late-gestation fetal sheep (n = 8 against 8 saline controls) raised heart, adrenal gland and spleen weights and raised skeletal myoblast proliferation, while uterine and umbilical blood flow and umbilical glucose, lactate and oxygen uptake rates were unchanged. Umbilical amino acid uptake rates and fetal amino acid concentrations actually fell.
Fetal sheep modelAxonal regeneration from a controlled-release scaffold
Thirty rats across six groups (n = 5) received a 1 cm sciatic nerve defect. A decellularised plant-derived conduit with GelMA and controlled IGF-1 LR3 release improved axonal regeneration on gait analysis, electrophysiology and histology to a level comparable with autologous nerve graft, without systemic toxicity.
Rodent modelIGF-1 LR3 Molecular Information
| Sequence | MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPA KSA |
| Sequence Length | 83 residues (70-residue mature IGF-1 plus a 13-residue N-terminal extension) |
| Modifications | Arg substituted for Glu at position 3 of the IGF-1 sequence; N-terminal extension Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn |
| Molecular Formula | C400H619N111O115S9 (folded, three disulfide bonds); C400H625N111O115S9 for the reduced chain |
| Molecular Weight | 9,111.5 g/mol folded; 9,117.6 g/mol calculated for the reduced chain |
| Disulfide Bonds | Three, at the positions corresponding to Cys6-Cys48, Cys18-Cys61 and Cys47-Cys52 of mature IGF-1 |
| CAS Number | 946870-92-4 |
| Parent Protein | Human IGF-1, UniProt P05019, mature chain residues 49 to 118 |
| Molecular Class | Recombinant protein, expressed in Escherichia coli as an N-terminally extended fusion and refolded in vitro |
| Native Counterpart | Mature human IGF-1, 70 residues, 7,648.7 g/mol folded |
How IGF-1 LR3 Was Engineered
The construct is an artefact of a manufacturing problem. Producing correctly folded IGF-1 in Escherichia coli is difficult because the 70-residue chain has to form three specific disulfide bonds and readily mis-pairs them. The Adelaide group solved that by expressing IGF-1 as a fusion carrying the first 46 residues of methionyl porcine growth hormone followed by the dipeptide Val-Asn. Those two residues create a unique hydroxylamine-sensitive Asn-Gly bond at the junction, so after inclusion bodies are isolated and the chain is refolded, a single chemical cleavage releases the growth factor.
Cleaving that fusion at a shorter point leaves 13 of the extension residues attached, and that truncated leader is what the word Long denotes. The extension turned out to be useful rather than merely tolerated: the hydrophobic leader improved the yield of correctly folded, biologically active product compared with refolding a normal-length IGF-1 chain. A production convenience became a design feature.
The same group made the whole matrix, which is why the structure-activity conclusion is firm rather than inferred. They produced Long IGF-I (extension only, no substitution), [Arg3]-IGF-I and [Gly3]-IGF-I (substitution only, no extension), and Long [Arg3]-IGF-I and Long [Gly3]-IGF-I with both. Comparing across that set is how the extension and the position 3 substitution were shown to contribute additively to loss of IGFBP affinity, and how it became clear that neither contributes anything to receptor affinity.
Why the Binding Proteins Are the Whole Story
Six IGF binding proteins circulate, and IGFBP-3 dominates. IGFBP-3 binds an IGF molecule together with the acid-labile subunit to form a stable 150 kDa ternary complex that cannot leave the vascular compartment. That complex functions as an intravascular store, and it is why the free fraction of circulating IGF-1 is a small percentage of the total. Change the ternary complex and the pharmacology changes with it.
A direct demonstration comes from a rat study on IGF-1-induced hypoglycaemia. A bolus of recombinant human IGF-1 lowered blood glucose, and co-administering an equimolar amount of either glycosylated or non-glycosylated IGFBP-3 blocked that effect. A mutant IGFBP-3 with reduced acid-labile subunit affinity only partially blocked it, and the molecular mass distribution explained why: 60 percent of the wild-type binding protein was in ternary complexes against 30 percent of the mutant. Ternary complex formation, not binding protein presence, is what neutralises the ligand.
Long [Arg3]-IGF-I is the molecule built to sit outside that system. That framing also predicts where the analogue will underperform. In a culture with no binding proteins in the medium, there is no sequestration to escape and the only property that matters is intrinsic receptor affinity, where the analogue is threefold worse than the native hormone. That is precisely what was measured in chicken embryo fibroblasts.
IGF-1 LR3 in Industrial Cell Culture
The largest documented application is not an animal application at all. LongR3 is a standard growth factor in serum-free Chinese hamster ovary media, where it substitutes for insulin. A 2000 comparison ran two serum-free CHO lines expressing recombinant cytokine receptors on each factor. One line grew without either, the other required one of them, and under production conditions LongR3 sustained viability of both lines better than insulin did.
A 2014 study went further and asked what the supplement does to the cell. Using a purpose-built 41,304-probe CHO microarray, the group profiled CHO transcriptomes cultured with and without LongR3. The effects ran from faster growth to delayed cell death, along with a distinct signature in cytoskeletal gene expression, which the authors read as cells spending less effort building a large cytoskeleton and more on dividing.
The consequences reach product quality. In an industrial CHO line producing an Fc-fusion protein, LongR3 raised productivity and shifted the N-linked glycosylation profile of the product. Glycosylation is a critical quality attribute of a therapeutic protein, so a media growth factor that moves it is an operational variable, not a neutral additive.
Adjacent uses follow the same logic. Substituting LongR3-IGF-1 for insulin allowed embryonic stem cells to differentiate into neuroprogenitors and insulin-secreting cells, which removes an obvious confound from a protocol whose readout is insulin. In bovine in vitro maturation, 739 cumulus-oocyte complexes matured with 100 ng/mL of either IGF-1 or LongR3-IGF-1 showed no difference in meiotic progression or apoptosis, though IGFBP4 expression in oocytes and COX2 expression in cumulus cells did differ between the groups. The analogue has also been expressed as a xylanase fusion in Pichia pastoris, an alternative to the E. coli route.
IGF-1 LR3 in Rodent Catabolic Models
The in vivo rodent work is unusually well controlled because it came from the same laboratory that built the molecule. The core model is a 150 g male rat given 20 micrograms of dexamethasone daily to induce catabolism. IGF-1 by implanted osmotic minipump produced dose-dependent effects on body weight and nitrogen retention, with the highest dose tested, 695 micrograms delivered daily, giving a 6 g gain over seven days against a 19 g loss in the dexamethasone-only group and an 18 g gain in pair-fed controls. Both low-IGFBP-affinity analogues, des(1-3)IGF-I and LR3IGF-I, were roughly 2.5-fold more potent.
The mechanism was measured on both sides of protein turnover rather than inferred. Muscle protein synthesis was assessed at the end of treatment, and breakdown was tracked throughout by 3-methylhistidine excretion, which fell from 83.5 to 65.1 micromol per kg over seven days at the top dose against 54.9 in pair-fed controls. The dexamethasone-induced changes in liver, spleen and heart weight moved back toward normal, and the gain in total carcass weight was nitrogen rather than fat.
A companion paper examined the gut specifically and found it to be the most IGF-responsive tissue in the model, with total gut weight rising by up to 60 percent and gut weight as a fraction of body weight by up to 32 percent. Stomach, small intestine and colon were all affected, and histology showed cross-sectional mass increasing rather than length, with proportional gains in wet weight, protein and DNA per unit length in both the mucosa and the muscularis. That gut trophic effect is a consistent finding across the low-IGFBP-affinity analogue literature and is rarely mentioned on product pages.
Timing mattered as much as amount. A later study infused LR3IGF-I continuously at 280 micrograms daily starting either two days before, concurrent with, or two days after a six-day dexamethasone infusion. In young rats, early treatment beat delayed treatment on nitrogen balance (90 against 31 mg of nitrogen daily), on carcass nitrogen gain, and on protein fractional synthesis rate. Older weight-stable female rats were markedly less responsive, and only early and concurrent treatment reduced the catabolic response at all.
The Fetal Sheep Programme
The most recent controlled in vivo data on this specific analogue come from a University of Colorado group studying fetal growth restriction in sheep, and the arc of three studies is more informative than any single result. In the first, catheterised late-gestation fetuses received a one-week intravenous infusion of LR3 IGF-1 (n = 8) or saline (n = 8), followed by a metabolic study measuring uterine and umbilical blood flow, nutrient uptake and fetal protein kinetics. Heart, adrenal and spleen weights rose and skeletal myoblast proliferation increased, but total fetal weight did not differ significantly and blood flow and umbilical glucose, lactate and oxygen uptake were unchanged. Umbilical amino acid uptake and fetal amino acid concentrations fell. The authors read this as more efficient use of available nutrients rather than increased delivery.
The second study followed an unwelcome observation from the first: fetal insulin secretion had fallen. A 90-minute infusion reduced fetal plasma insulin and cut insulin concentrations during a hyperglycaemic clamp by 66 percent against controls. Islets isolated immediately after that infusion secreted normally in vitro, so the acute suppression looked functional and reversible rather than a structural defect in the beta cell.
The third study tested the analogue in the population it had been proposed for and it did not work. Growth-restricted fetal sheep received either LR3 IGF-1 at 1.17 micrograms per kg per hour (n = 7) or vehicle (n = 7) for one week. Body weight, insulin, glucose, oxygen and glucose-stimulated insulin secretion were all unchanged between groups. Circulating amino acids fell in the treated group, consistent with increased utilisation, and the authors concluded that amino acid, insulin, glucose or oxygen availability would likely have to be raised alongside the analogue for growth to follow. This is the clearest published example of the compound being tested against a real endpoint and missing it.
Species Differences and the Pig Result
Product pages generally describe the analogue as uniformly anabolic. The livestock literature does not agree, and the disagreement is instructive rather than marginal. A four-day infusion of LR3IGF-I at 180 micrograms per kg per day in finisher pigs decreased average daily gain and food intake, and lowered plasma IGFBP-3, IGF-1 and insulin concentrations.
The likely reason is feedback. Mean plasma growth hormone fell by 23 percent and the area under the growth hormone pulse curve fell by 60 percent. Co-administering porcine growth hormone alongside the analogue raised mean growth hormone concentrations but did not restore the pulse area and did not rescue growth performance, with insulin, IGFBP-3 and endogenous IGF-1 remaining suppressed. Native IGF-1 at the same infusion rate also suppressed growth hormone and insulin but left average daily gain unchanged.
The practical reading is that the analogue's effect depends on how tightly the species regulates its own somatotropic axis and on whether the animal is catabolic to begin with. Rats made catabolic with a glucocorticoid respond well. Normal finisher pigs respond by shutting down endogenous growth factor production. Extrapolating a rat result to another species is exactly the step this literature shows to be unsafe.
What Is Actually Known About IGF-1 LR3 Half-Life
A figure of 20 to 30 hours is repeated on essentially every vendor page, usually alongside a claim that native IGF-1 lasts ten minutes. The 20 to 30 hour number does not appear in the primary literature on this analogue, and no citation is offered for it anywhere it is repeated. What can be said with a source is that free native IGF-1 is cleared in minutes while IGF-1 held in the IGFBP-3 and acid-labile subunit ternary complex persists for hours, and that Long [Arg3]-IGF-I is largely excluded from that complex.
The one published measurement points the other way. An antidoping laboratory validated an immunopurification and high-resolution mass spectrometry method for IGF-1 analogues and then tracked them in rats after a single 100 micrograms per kg dose delivered into skeletal muscle. Unchanged Des(1-3)-IGF-I and R3-IGF-I remained detectable to 24 hours. Unchanged LongR3-IGF-I disappeared rapidly after 4 hours. What persisted were N-terminally clipped degradation products: a newly described Des(1)-LongR3-IGF-I, plus Des(1-10)- and Des(1-11)-LongR3-IGF-I, the last of which was detectable to 16 hours. The same products formed when the analogues were incubated in human whole blood in vitro.
The two observations are not in conflict once separated. Escaping the binding proteins raises the free fraction of ligand available to the receptor; it does not make the intact molecule resistant to proteolysis, and the exposed hydrophobic N-terminal extension is a natural substrate for aminopeptidase trimming. An unbound protein is also cleared faster than one parked in a 150 kDa complex. Anyone designing an in vivo experiment around this compound should treat the 20 to 30 hour figure as unsourced and design against the measured data.
Identity, Purity and Analytical Characterisation
Two well-documented findings show why identity confirmation on this compound needs more than a purity percentage. In 2010 a Cologne doping control laboratory analysed a confiscated injection vial and identified its contents by nano-UPLC and high-resolution mass spectrometry of both the intact and trypsinised protein. It was Long-R3-IGF-I carrying a hexahistidine tag on the C-terminus, joined by a Leu-Glu linker. His tags are added during recombinant production for affinity purification and are enzymatically removed when placed at the N-terminus; a C-terminal tag left in place marks the material as a by-product of a biochemical research production run rather than something made to be administered.
The second finding is oxidation. The antidoping method development study reported abundant oxidised forms in black market IGF-1 analogue products, to the point that the authors concluded a detection method has to monitor the mono-oxidised species alongside the native one. The chemistry is predictable: this molecule carries three methionine residues, two of them in the N-terminal extension, and methionine sulfoxide formation is one of the commonest degradation routes for a lyophilised protein exposed to air or peroxide-contaminated excipients.
The molecular weight in circulation is also worth checking. Almost every published specification gives 9,117.5 or 9,117.6 g/mol. That is the calculated mass of the reduced 83-residue chain. The correctly folded protein carries three disulfide bonds and therefore weighs about 6 daltons less, roughly 9,111.5 g/mol, and an intact-mass measurement on properly folded material should land there. A quoted mass of 9,117 alongside a claim of correct folding is internally inconsistent. One widely copied formula, C423H684N122O128S7, is simply wrong: a protein with six cysteines and three methionines must contain nine sulfur atoms, not seven.
The practical consequence is that a single HPLC purity number is not sufficient characterisation for this compound. Reversed-phase HPLC separates by hydrophobicity and will resolve an oxidised variant poorly at best. SDS-PAGE cannot resolve a 6 dalton disulfide difference or an 840 dalton tag with confidence. Intact-mass spectrometry answers all three questions at once: correct sequence mass, correct disulfide state, and the presence or absence of an unremoved purification tag.
Handling and Stability of a Recombinant Protein
Long [Arg3]-IGF-I is a folded 9 kDa protein produced by bacterial expression and in vitro refolding, not a solid-phase synthetic peptide, and its failure modes are those of a protein. The three disulfide bonds are the fragile part. Thiol contamination, alkaline pH or elevated temperature can promote disulfide scrambling, and a scrambled molecule can retain its exact mass and its apparent HPLC purity while having lost receptor binding entirely. Activity loss with no change in the certificate of analysis is the characteristic signature.
Chemical degradation runs on two clocks. Methionine oxidation affects the three methionines and is driven by dissolved oxygen, light and trace metals. Asparagine deamidation and aspartate isomerisation proceed faster in solution than in the lyophilised state and faster still at neutral to alkaline pH. Both are why the compound ships lyophilised and why the shelf life of a solution is measured in weeks rather than the two years quoted for the dry powder.
Two handling problems are specific to working at the concentrations this molecule is active at. Below roughly 1 microgram per mL, a 9 kDa protein adsorbs measurably onto glass and polypropylene surfaces, which is why cell culture protocols routinely include a carrier protein or a non-ionic surfactant in the dilution buffer. And each freeze-thaw cycle drives aggregation at the ice-water interface, so single-use aliquots preserve activity that repeated cycling on one vial does not.
The literature offers a useful check on all of this. In the fetal sheep and rodent work, biological activity was confirmed against a functional endpoint rather than assumed from a purity figure. For a compound whose potency depends on an intact fold and an intact N-terminal extension, a proliferation or receptor phosphorylation assay is the only characterisation that reports on the property actually being purchased.
IGF-1 LR3 Compared With Related Compounds
Des(1-3)IGF-I is the other classic low-IGFBP-affinity analogue and the closest comparison. It is a 67-residue truncation missing the N-terminal Gly-Pro-Glu tripeptide, and it occurs naturally in fetal brain rather than being wholly engineered. In the original Adelaide comparisons it matched Long [Arg3]-IGF-I for potency in IGFBP-secreting cultures, and the two were treated as an equivalent pair throughout the rat catabolism work. The antidoping pharmacokinetic study separates them clearly: unchanged Des(1-3)-IGF-I was detectable in rats to 24 hours after a single administration, where unchanged LongR3-IGF-I was gone within 4.
Mechano growth factor is a different molecule despite the shared IGF-1 origin. It is a splice variant of the IGF-1 gene induced in skeletal muscle by mechanical loading, and its distinguishing activity sits in its unique C-terminal E domain peptide, which acts on satellite cell proliferation through a receptor that is not IGF-1R. A study of Long [Arg3]-IGF-I says nothing about mechano growth factor and the reverse is equally true.
The growth hormone secretagogues in the same catalogue category operate one level upstream and are not substitutes. Compounds such as ipamorelin, CJC-1295 and tesamorelin act on the pituitary to raise endogenous growth hormone, which raises hepatic IGF-1 production, which is then captured into the normal IGFBP system. Long [Arg3]-IGF-I bypasses the entire axis and, as the pig data show, actively suppresses it. An experiment intended to probe pituitary regulation and an experiment intended to probe IGF-1R signalling call for different compounds.
The Human Evidence Gap
There is no registered human clinical trial of Long [Arg3]-IGF-I. A ClinicalTrials.gov search returns no interventional study of this analogue at any phase, and the compound was never developed for human use in the first place: it was built as a laboratory reagent and reached commercial scale through cell culture media supply.
The human IGF-1 record that does exist belongs to a different molecule. Mecasermin is recombinant native IGF-1, licensed for severe primary IGF-1 deficiency, and its safety and efficacy data describe a molecule that circulates in the normal ternary complex. Long [Arg3]-IGF-I was engineered specifically to escape that complex, which is the parameter that governs free ligand exposure. No part of the mecasermin record transfers.
The analogue does appear in one human-facing context: antidoping. Long [Arg3]-IGF-I, Des(1-3)-IGF-I and R3-IGF-I are prohibited substances in sport under the World Anti-Doping Agency's growth factor category, and validated immunopurification and mass spectrometry detection methods for all three have been published. The confiscated-vial case report and the survey of black market product quality both come out of that programme, which is also why the best available data on what is actually in an uncontrolled vial comes from doping control laboratories rather than from manufacturers.
IGF-1 LR3 FAQ
IGF-1 LR3 Research Summary
Long [Arg3]-IGF-I is one of the better-documented engineered growth factor analogues, and the documentation says something narrower than the marketing does. Two structural changes, an arginine for glutamate at position 3 and a 13-residue N-terminal leader, strip IGF binding protein affinity while slightly reducing receptor affinity. Every observed potency advantage traces to the first effect, and the original authors proved it by showing the advantage inverts in a culture with no binding proteins present.
Where the compound has an unambiguous, reproducible record is in cell culture. It replaces insulin in serum-free CHO production media, it measurably changes CHO transcriptome and product glycosylation, and it enables stem cell differentiation protocols whose readout insulin would confound. In animals the picture is mixed and species-dependent: strongly anabolic and markedly gut-trophic in glucocorticoid-treated rats, growth-suppressing in normal pigs through feedback onto the somatotropic axis, and effective on some organ weights but not on total growth in the fetal sheep model where it was tested most rigorously.
Two gaps deserve to be stated plainly. The 20 to 30 hour half-life figure repeated across the market has no primary source, and the one measurement that exists found the unchanged molecule gone from rat circulation within four hours. And there is no human trial record for this analogue at all, only a doping control literature that has characterised what turns up in uncontrolled vials, including material carrying an unremoved purification tag. Both facts should shape how an experiment using this compound is designed and how its results are interpreted.
Scientific References
Primary literature and public trial registries only. No supplier or retailer pages are cited.
- 1Production and characterization of recombinant insulin-like growth factor-I (IGF-I) and potent analogues of IGF-I, with Gly or Arg substituted for Glu3, following their expression in Escherichia coli as fusion proteinsKing R, Wells JR, Krieg P, et al. · Journal of Molecular Endocrinology · 1992
- 2Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potencyFrancis GL, Ross M, Ballard FJ, et al. · Journal of Molecular Endocrinology · 1992
- 3Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated ratsTomas FM, Knowles SE, Owens PC, et al. · Biochemical Journal · 1992
- 4Insulin-like growth factor-I and its N-terminal modified analogues induce marked gut growth in dexamethasone-treated ratsRead LC, Tomas FM, Howarth GS, et al. · Journal of Endocrinology · 1992
- 5The anti-catabolic efficacy of insulin-like growth factor-I is enhanced by its early administration to rats receiving dexamethasoneTomas FM · Journal of Endocrinology · 1998
- 6Long [R3] insulin-like growth factor-I reduces growth, plasma growth hormone, IGF binding protein-3 and endogenous IGF-I concentrations in pigsDunaiski V, Dunshea FR, Walton PE, Goddard C · Journal of Endocrinology · 1997
- 7Effects of insulin and LongR(3) on serum-free Chinese hamster ovary cell cultures expressing two recombinant proteinsMorris AE, Schmid J · Biotechnology Progress · 2000
- 8Transcriptome analyses of CHO cells with the next-generation microarray CHO41K: development and validation by analysing the influence of the growth stimulating substance IGF-1 substitute LongR(3)Becker J, Timmermann C, Rupp O, et al. · Journal of Biotechnology · 2014
- 9LongR3 enhances Fc-fusion protein N-linked glycosylation while improving protein productivity in an industrial CHO cell lineQian Y, Lewis AM, Sidnam SM, et al. · Process Biochemistry · 2017
- 10Replacement of insulin by LongR3-IGF-1 allows for the differentiation of ES cells into neuroprogenitors and insulin-secreting cellsBieberich E · Analytical Biochemistry · 2005
- 11Molecular and cellular effects of insulin-like growth factor-1 and LongR3-IGF-1 on in vitro maturation of bovine oocytes: comparative studyAraujo MS, Guastali MD, Paulini F, et al. · Growth Hormone & IGF Research · 2020
- 12Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastorisLu Z, Liu N, Huang H, et al. · Applied Microbiology and Biotechnology · 2023
- 13IGF-1 infusion to fetal sheep increases organ growth but not by stimulating nutrient transfer to the fetusStremming J, Heard S, White A, et al. · American Journal of Physiology: Endocrinology and Metabolism · 2021
- 14Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion into fetal sheep does not persist in isolated isletsWhite A, Stremming J, Brown LD, Rozance PJ · Journal of Developmental Origins of Health and Disease · 2023
- 15IGF-1 LR3 does not promote growth in late-gestation growth-restricted fetal sheepWhite A, Stremming J, Wesolowski SR, et al. · American Journal of Physiology: Endocrinology and Metabolism · 2025
- 16Detection of LongR3-IGF-I, Des(1-3)-IGF-I, and R3-IGF-I using immunopurification and high resolution mass spectrometry for antidoping purposesMongongu C, Coudore F, Domergue V, et al. · Drug Testing and Analysis · 2021
- 17Detection of His-tagged Long-R3-IGF-I in a black market productKohler M, Thomas A, Walpurgis K, et al. · Growth Hormone & IGF Research · 2010
- 18Impaired blockade of insulin-like growth factor I (IGF-I)-induced hypoglycemia by IGF binding protein-3 analog with reduced ternary complex-forming abilityFirth SM, McDougall F, McLachlan AJ, Baxter RC · Endocrinology · 2002
- 19Intranasal long R3 insulin-like growth factor-1 treatment promotes amyloid plaque remodeling in cerebral cortex but fails to preserve cognitive function in male 5XFAD miceEngel MG, Narayan S, Cui MH, et al. · Journal of Alzheimer's Disease · 2025
- 20Decellularized Alstroemeria stem-based nerve conduit integrated with GelMA and controlled IGF-1 LR3 release for enhanced rat sciatic nerve regenerationYavuz E, Sagir MS, Ercan A, et al. · International Journal of Biological Macromolecules · 2025
- 21UniProtKB P05019 (IGF1_HUMAN): Insulin-like growth factor I, Homo sapiensUniProt Consortium · UniProt Knowledgebase · 2026
Disclaimer
All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are furnished for in-vitro studies only. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease.
IGF-1 LR3 1mg: frequently asked questions
Answered from the product record and the certificate file. Volta does not answer questions about administration, dosing or protocols.
What is supplied in a 1 mg vial of IGF-1 LR3?
A sealed single-use vial containing 1 mg of IGF-1 LR3 as a lyophilized powder. Soluble in bacteriostatic water. No diluent, syringe or other supply is included.
Is IGF-1 LR3 supplied for human use?
No. For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Volta does not provide dosing, administration or protocol guidance for any material listed.
What purity is this IGF-1 LR3 released to?
>99% by HPLC. That figure is a release specification, a threshold Volta sets for every batch, and it is not the same kind of statement as a purity measured by a named laboratory for a named lot.
Is there a certificate of analysis for this IGF-1 LR3 vial?
A batch-specific Certificate of Analysis is available for this product on request. It is not published on the site yet: the batch history on the quality page lists the certificates already published, and this vial is covered by the release specification until its own is added there.
How is IGF-1 LR3 identified?
molecular weight 9,111 g/mol (9.1 kDa). Those identifiers are what an incoming-goods check compares a certificate against, and they are stated here so the comparison can be made before ordering.
How should IGF-1 LR3 be stored before reconstitution?
Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.
Where does this ship from?
British Columbia, Canada. Canadian orders are domestic, so they clear no customs and pay no import duty. International orders ship from the same facility.
Explore Research
Peptide Tools
IGF-1 LR3 research
IGF-1 LR3 is insulin-like growth factor 1 with a 13-residue N-terminal extension and an Arg3Glu substitution, modifications that reduce binding-protein affinity and lengthen its measured half-life. Everything Volta publishes on this compound, across every vial size, is collected on IGF-1 LR3 handling, evidence and certificates.
Research on IGF-1 LR3
Handling and documentation
IGF-1 LR3 is one of the compounds in Volta's growth hormone research peptides catalogue, which collects the rest of the range studied in this area alongside the comparisons and guides that cover it.
More from the research catalogue
Every compound below has its own specification, batch number and certificate page, whether or not a vial is in stock today. Supplied for laboratory research use only.
Related research compounds
- Ipamorelin 10mgrestocking
- Ipamorelin 5mg
- PEG-MGF 2mgrestocking
- Sermorelin 10mg
- Semaglutide 20mg









