Compound research hub
IGF-1 LR3: Research, Handling and Batch Documentation
IGF-1 LR3 is insulin-like growth factor 1 with a 13-residue N-terminal extension and an Arg3Glu substitution, modifications that reduce binding-protein affinity and lengthen its measured half-life.
Part of Volta's peptides.
Identity and specification
- Form
- Lyophilized powder
- Other known names
- Long R3 IGF-1, Long Arg3 Insulin-like Growth Factor-1
- Compound class
- IGF-1 analogue
- Sequence, one-letter
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Sequence, three-letter
- Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala
- Residues
- 83
- CAS number
- 946870-92-4
- Molecular weight
- 9,111 g/mol (9.1 kDa)
- Production
- Synthetic, by solid-phase peptide synthesis
- Solubility
- Soluble in sterile water
- Shelf life
- 24 months from date of manufacture
Molecular structure, sequence and the published laboratory studies on IGF-1 LR3 are in the compound library entry for IGF-1 LR3.
Vial sizes available
Every size of IGF-1 LR3 Volta lists, in stock or not. Each is a separate catalogue page with its own batch number and specification table.
- Restocking
IGF-1 LR3 1mg 1mgBatch #: VPIG1100
Purity and batch documentation
Volta's release specification is >99% (HPLC). That is a threshold we set. >99% is the specification every batch is released to. The figure on a certificate is what a laboratory measured for one lot.
No third-party certificate has been published for IGF-1 LR3yet. The certificates Volta does publish, with the laboratory's own verification link on each, are in the certificate archive.
Research on IGF-1 LR3
Handling and stability
Laboratory guides
Regulatory context
More peptides
IGF-1 LR3 sits in Volta's peptides group, alongside the other compounds of the same composition. The whole range is on the full research catalogue, and the library of comparisons and guides is under peptide research.