Antimicrobial / Immune Research Peptides Guide

This guide covers 9 research peptides in the Antimicrobial / Immune category. Each compound is evaluated on its evidence base, mechanism, safety profile, and current clinical status.

LL-37 stands out as the only human cathelicidin antimicrobial peptide, comprising 37 amino acids (sequence: [LL-37, 37 aa]). Research highlights its broad-spectrum antimicrobial properties against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond its direct antimicrobial effects, LL-37 is implicated in various biological processes, including immunomodulation, wound healing, and angiogenesis. It is endogenously produced by epithelial and immune cells, with its synthesis enhanced by vitamin D. A randomized controlled trial has explored the efficacy of topical LL-37 in the treatment of venous leg ulcers, indicating potential therapeutic applications in wound management, although further clinical evidence is warranted to establish its efficacy across broader indications. Use cases: Immune Support, Antimicrobial.

Beta-defensins represent a family of small cationic antimicrobial peptides (36-45 amino acids, MW ~4-5 kDa) synthesized by epithelial cells throughout the body. The three most extensively studied human beta-defensins, HBD-1, HBD-2, and HBD-3, play critical roles in innate mucosal immunity. HBD-1 is constitutively expressed, while HBD-2 is inducible during infection and inflammation, and HBD-3 exhibits broad-spectrum antimicrobial activity, including effectiveness against methicillin-resistant Staphylococcus aureus (MRSA). Given their essential role in immune defense, beta-defensins are investigated not only as potential biomarkers for various diseases but also as templates for the development of novel antimicrobial agents. However, as of now, no therapeutic products derived from beta-defensins are in clinical development. Use cases: Immune Support, Antimicrobial Research.

Alpha-defensins encompass a group of small cationic antimicrobial peptides (29-35 amino acids, MW ~3.5-4.5 kDa) characterized by three intramolecular disulfide bonds. Notably, human neutrophil peptides (HNP-1 to HNP-4) are stored in azurophilic granules and released upon neutrophil activation, while defensins HD-5 and HD-6 are produced by Paneth cells in the small intestine. These peptides are pivotal in the innate immune response, acting as key effector molecules against a range of pathogens. Research has highlighted their utility as biomarkers, such as the alpha-defensin test in synovial fluid, which aids in diagnosing periprosthetic joint infections. Despite their significant biological roles, alpha-defensins have not yet progressed to therapeutic applications. Use cases: Immune Support, Antimicrobial Research, Diagnostics.

Lactoferricin, a 25-amino-acid antimicrobial peptide derived from bovine lactoferrin (specifically the f17-41 fragment), has garnered attention for its potent antimicrobial properties. With a molecular weight of approximately 3126 g/mol, lactoferricin exhibits broad-spectrum activity against various pathogens, including bacteria, fungi, viruses, and parasites. Notably, studies suggest that it may also possess anticancer properties, as evidenced by preclinical research indicating its potential to inhibit tumor cell growth. Despite these promising findings, lactoferricin remains confined to preclinical research, with no clinical trials registered for its use as a standalone therapeutic agent, limiting its application in clinical settings. Use cases: Antimicrobial Research, Immune Support.

Melittin is a 26-amino-acid cationic amphipathic peptide (sequence: GIGAVLKVLTTGLPALISWIKRKRQQ) that constitutes a significant portion (40-60%) of honeybee venom. This peptide is primarily responsible for the pain and inflammation associated with bee stings, as well as hemolytic activity. Extensive preclinical studies have explored melittin's potential as an antimicrobial, anticancer, and anti-inflammatory agent. However, its therapeutic applications are limited due to pronounced cytotoxicity and hemolytic effects, which pose challenges for its development into a safe pharmaceutical product. Despite its traditional use in apitherapy, where bee venom is utilized for various health benefits, no approved pharmaceutical products based on isolated melittin currently exist. Use cases: Antimicrobial Research, Anticancer Research.

Histatin-5, a 24-amino-acid peptide rich in histidine, is a prominent member of the histatin family secreted by human salivary glands. It plays a critical role in the innate immune defense of the oral cavity, particularly against Candida albicans, a common fungal pathogen. Research indicates that Histatin-5 exhibits potent antifungal activity, functioning through mechanisms that disrupt fungal cell membranes and inhibit growth. Studies have explored its potential as a template for antifungal drug design, aiming to leverage its natural properties to develop novel therapeutics. Despite its significant role in oral health, there are currently no therapeutic products derived from Histatin-5 in development, limiting its application to basic research and potential future innovations in antifungal strategies.

Pexiganan (MSI-78) is a 22-amino-acid synthetic analog of the naturally occurring antimicrobial peptide magainin 2, originally sourced from the skin of the African clawed frog. This peptide has demonstrated broad-spectrum bactericidal activity, making it a candidate for topical applications, specifically in the treatment of infected diabetic foot ulcers. Although Pexiganan reached Phase III clinical trials and was formulated into a topical cream (Locilex), it ultimately failed to secure FDA approval following two submissions in 1999 and 2016, as it was determined to lack superiority over existing treatments. This outcome underscores the challenges faced in translating promising preclinical findings into successful clinical applications, particularly in an area as competitive as wound care.

Omiganan (MBI 226) is a 12-amino-acid synthetic cationic antimicrobial peptide derived from indolicidin, a natural peptide found in bovine neutrophils. It has been evaluated in Phase III clinical trials for preventing catheter-related infections and as a topical treatment for rosacea (under the designation CLS001). Despite its initial promise, Omiganan has not received regulatory approval for either indication. The peptide's mechanism of action involves disrupting microbial membranes, which is a common strategy among antimicrobial peptides. The lack of approval highlights the complexities of demonstrating clinical efficacy in diverse applications, particularly in dermatology, where competition with established therapies is significant. Further research may be needed to refine its applications and explore potential new indications.

Brilacidin (PMX-30063) is a synthetic peptidomimetic designed to mimic the structure and function of host defense peptides, particularly defensins. This compound has undergone Phase II clinical trials for acute bacterial skin and skin structure infections (ABSSSI), showing positive results in its efficacy. Additionally, Brilacidin has been investigated for its potential in treating oral mucositis and has been explored in vitro for activity against COVID-19. Its unique mechanism, which involves disrupting bacterial membranes, positions it as a noteworthy candidate in the field of anti-infective development. However, as of now, no Phase III trials have been initiated, indicating the need for further validation of its clinical efficacy and safety in larger populations.