Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|
CJC-1295 DAC 5mg specification card: catalogue number, CAS number, molecular formula and purity

CJC-1295 DAC 5mg Peptide

For in-vitro laboratory research only. Not for human or animal administration.

Batch #: VPCD5100

$54 USD

Get Notified When Available

This product is currently out of stock. Enter your email and we'll notify you the moment it's back.

Application formLyophilized powder
StorageRefrigerated
Purity>99%
Weight5mg
CAS Number863288-34-0
Molecular FormulaC₁₅₂H₂₅₂N₄₄O₄₂

Research Use Only

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Batch-specific Certificates of Analysis available for all products.

CJC-1295 DAC 5mg: overview

What the vial contains and what the material is, stated as specifications rather than as outcomes.

CJC-1295 DAC supplied as a lyophilized powder in a sealed single-use vial containing 5 mg of material. CJC-1295 DAC: molecular formula C₁₅₂H₂₅₂N₄₄O₄₂, molecular weight 3,367.9 g/mol, CAS 863288-34-0. Released to a specification of >99% purity by HPLC. Soluble in bacteriostatic water. Supplied for in-vitro laboratory research only. Not a drug, food or supplement. Not for human or veterinary use.

Volta does not provide dosing, administration or protocol guidance for any material listed.

CJC-1295 DAC 5mg specifications

Every field the product record holds. A field with no value is omitted rather than printed as a dash.

Fill
5mg
Form
Lyophilized powder
CAS number
863288-34-0
Molecular formula
C₁₅₂H₂₅₂N₄₄O₄₂
Molecular weight
3,367.9 g/mol
Solubility
Soluble in bacteriostatic water
Shelf life
24 months from date of manufacture

CJC-1295 DAC analytical verification and batch documentation

What the purity figure on this page is, who measured what, and which of the two a reader is looking at.

Specification. Every batch is released to >99% purity by HPLC. That is a threshold Volta sets, and it is a promise rather than a measurement.

Measurement. No certificate for this compound is published on the site yet. A batch-specific Certificate of Analysis is available on request, and the batch history lists the ones already published. Until one is published for this material, the figure above is the release specification and nothing on this page is a laboratory result.

Checking a certificate. The batch number printed beside the price is derived from the compound code and the vial strength; the lot number on a certificate is transcribed from the document. They are produced independently, so comparing them is a real check. How to read one is set out in the quality and testing methodology page.

For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease.

CJC-1295 with DAC (Drug Affinity Complex) is a modified growth hormone-releasing hormone analog with an extended half-life due to its DAC modification. Studied for sustained growth hormone release patterns and long-acting GH-axis modulation research.

  • Released to a >99% purity specification by HPLC
  • Lyophilized powder, 5mg per vial
  • Soluble in bacteriostatic water
  • For laboratory research use only

Frequently Bought Together

CJC-1295 DAC 5mg
This item

CJC-1295 DAC 5mg

5mg

$54 USD

Bundle & Save

2
2 items

$103 USD

Save $5.15 USD

3
3 items

$177 USD

Save $17.70 USD

4
4 items

$213 USD

Save $31.95 USD

5
5 items

$248 USD

Save $49.60 USD

Your selection (5 items)
$248 USDSave $49.60 USD

Click any product above to toggle selection

Related research materials

Tesamorelin 10mg
Tesamorelin 10mg

Growth Hormone Research Peptides · 10mg

$74 USD
CJC-1295 No DAC + Ipamorelin 10mg (5+5)
CJC-1295 No DAC + Ipamorelin 10mg (5+5)

Growth Hormone Research Peptides · 10mg

$49 USD
Ipamorelin 5mg
Ipamorelin 5mg

Growth Hormone Research Peptides · 5mg

$36 USD
GHRP-2 5mg
GHRP-2 5mg

Growth Hormone Research Peptides · 5mg

$28 USD
GHRP-6 5mg
GHRP-6 5mg

Growth Hormone Research Peptides · 5mg

$33.16 USD
Sermorelin 10mg
Sermorelin 10mg

Growth Hormone Research Peptides · 10mg

$69 USD
BPC-157 5mg
BPC-157 5mg

Healing & Recovery Research Peptides · 5mg

$35 USD
BPC-157 10mg
BPC-157 10mg

Healing & Recovery Research Peptides · 10mg

$46 USD

CJC-1295 DAC 5mg: what is in the vial

The arithmetic specific to this 5mg vial, and what a milligram of CJC-1295 DAC costs in each strength the catalogue carries. Concentrations are stated, not recommended.

Vial contents

5 mg

Lyophilised powder, reconstituted by the buyer

Cost of material

$10.80 / mg USD

CA$15.40 / mg in Canadian dollars

Concentration at each diluent volume

5 mg of dry material reaches these concentrations in the volumes below. A U-100 syringe marking is 0.01 ml by definition, so the last column is a unit conversion at each concentration rather than a quantity to use.

Diluent addedConcentrationIn 0.1 mlPer U-100 unit
1 ml5 mg/ml500 mcg50 mcg
2 ml2.5 mg/ml250 mcg25 mcg
3 ml1.67 mg/ml166.7 mcg16.7 mcg
5 ml1 mg/ml100 mcg10 mcg

For a volume this table does not list, the reconstitution calculator takes any vial size and diluent volume.

CJC-1295 DAC purity and identity: how the figure is measured

What >99% (HPLC) means, the masses an identity check has to land on, and the entries that make a certificate of analysis checkable rather than decorative.

Stated purity

>99% (HPLC)

Area percent of the main peak by reversed-phase HPLC

Average mass

3,367.9 g/mol

The figure an identity check has to land on

Detection

280 nm

A 1 mg/ml solution reads about 0.61 AU in a 1 cm cell

Identity by mass: the ions to expect

An electrospray source protonates the molecule rather than weighing it neutral, so a spectrum shows a series of charge states rather than the molecular weight itself. These are the m/z values 3,367.9 g/mol produces, and they are what a mass spectrum on a certificate for CJC-1295 DAC has to match.

IonChargeExpected m/z
[M+H]+1+3,368.91
[M+2H]2+2+1,684.96

A peptide this size is normally reported at its doubly and triply charged states, and the singly charged ion may not appear at usable intensity at all. A spectrum showing only one of these is not a failed identity check.

Why 280 nm

The sequence carries 2 Tyr, so it absorbs at 280 nm as well as at 214 nm on the peptide bond.

This matters when reading someone else's certificate: a purity figure quoted at 280 nm for a compound with no aromatic residue is measuring an absorbance the molecule does not have.

What a certificate for CJC-1295 DAC should carry

A purity percentage on its own is not checkable. These are the entries that make one verifiable, and their absence is the most common weakness in a research-peptide certificate.

  • The chromatogram, not only the number

    A stated area percent with no trace behind it cannot be read for the shape of the main peak or for what eluted beside it. The HPLC interpreter walks through what a trace shows.

  • Net peptide content, separately from gross mass

    A lyophilised peptide is a salt, usually of trifluoroacetic or acetic acid, plus residual water. The vial's stated milligrams are gross; net peptide content is the fraction of that mass which is the molecule. The two differ by ten to twenty percent routinely, and only one of them is what the price is per milligram of. The net peptide content calculator converts between them.

  • The counterion, named

    Which salt form the powder is in changes the net content and the pH the powder dissolves at. A certificate that never names it leaves both unknowable.

  • Water content, by a stated method

    Loss on drying and Karl Fischer titration give different numbers, and a water figure with no method attached cannot be compared with anyone else's.

  • A laboratory and a report identifier

    Without both, nothing on the document can be traced back to the laboratory that issued it. The red flag checker lists the rest.

Batch certificates are published as page images in the certificate library. The source PDFs are never served: a certificate is the most forgeable document a supplier publishes, and an editable copy carrying an accredited laboratory's letterhead is worth more to a counterfeiter than to a customer.

CJC-1295 DAC storage and stability

Handling as the product record states it, followed by the degradation chemistry this particular sequence is and is not exposed to.

Handling

Store at -20°C. Reconstitute in bacteriostatic water. After reconstitution, store at 2-8°C.

What degrades this compound

Each of these follows from the molecule itself rather than from general peptide handling.

  • Oxidation

    1 Met

    These side chains oxidise on contact with dissolved oxygen and with peroxide traces in diluents. Oxidation adds 16 daltons per event, so it shows up on a mass spectrum as a satellite peak above the parent and on a chromatogram as a shoulder ahead of the main peak. Minimise headspace air, and do not use a diluent that has been standing open.

  • Deamidation

    3 Gln

    Asparagine and glutamine lose their side-chain amide in aqueous solution, becoming aspartate and glutamate. The product is one dalton heavier and one charge more acidic, which moves its retention time without changing its size much, so it reads as an extra peak rather than a smaller one. No asparagine here is followed by glycine, serine or histidine, the three neighbours that accelerate the reaction, so the rate is the slower baseline one.

  • Light sensitivity

    2 Tyr

    The aromatic side chains that make this compound visible at 280 nm are the same ones that absorb ultraviolet light and photo-oxidise. This is the residue-level reason behind the instruction to store in the dark, and it is why an amber vial is not decoration.

What holds up

The degradation routes this compound is not exposed to, which is as specific a fact as the ones it is.

  • Net hydrophilic

    GRAVY -0.80

    A negative grand average of hydropathy means the side chains are on balance polar, which is the profile that stays in solution rather than associating. Freeze-thaw cycles are still worth avoiding, but this compound is not one of the hydrophobic sequences that aggregate irreversibly at an ice front.

  • Solubility window

    calculated pI 10.7, net charge 5 at pH 7

    A peptide is least soluble within about a pH unit of its isoelectric point, where it carries no net charge. This one is far enough from neutral that it holds a real charge in an ordinary diluent, which is what keeps it dissolved.

Derived from the primary sequence YADAIFTQSYRKVLASQEEKSARKLLQDIMSRGRRKGSTFSSS, calculated isoelectric point 10.7, GRAVY -0.802. Check the arithmetic with the peptide property calculator and the freeze-thaw estimator.

CJC-1295 DAC compared with GHRP-2 and GHRP-6

Pharmacological class, half-life, evidence grade, competition status and cost per milligram, side by side.

CompoundClassHalf-lifeEvidenceWADACheapest per mg
CJC-1295 with DACthis pageGrowth Hormone~8 daysCPhase I-II data; research compoundProhibited$10.805mg vial, out of stock
GHRP-2Growth Hormone Secretagogue~15–60 minutesCPhase I–II Clinical TrialsProhibited$5.605mg vial
GHRP-6Growth Hormone Secretagogue~15–60 minutesDPreclinicalProhibited$6.635mg vial
IpamorelinGrowth Hormone Secretagogue~2 hoursDPreclinicalProhibited$7.205mg vial
SermorelinGrowth Hormone Secretagogue~10–20 minutesCPhase I–II Clinical TrialsProhibited$6.9010mg vial

Evidence grades and half-lives are as recorded in the compound database, which cites its own sources on each compound page. Per-milligram prices are the cheapest strength each compound is currently listed at, in US dollars, and an out-of-stock note means that figure is not purchasable today. Cross-trial comparisons of efficacy are not comparisons: no head-to-head trial exists for most of these pairs.

CJC-1295 DAC in Canada

Price in Canadian dollars, where the parcel ships from, and how long it takes.

Price in CAD

CA$77

The figure charged, not a converted estimate

Ships from

British Columbia

A domestic parcel, so no import clearance step

Transit

2 to 5 business days

After 1 to 2 business days of handling

Free standard shipping

Over CA$250

A bar set for this market, not converted from the US one

CJC-1295 DAC 5mg ships from British Columbia to Canadian addresses, so the parcel never crosses a border. That removes the failure a Canadian buyer of research peptides is usually weighing: an inbound international shipment can be held for import clearance or seized, and a domestic one has no clearance step to be held at.

Shipping is quoted live against the delivery address at checkout rather than estimated here, and both the standard and express tiers show their price and transit window before a payment method is chosen. The figure the page shows is the figure the rail charges: all three settlement rails price shipping through the same functions the quote does.

The Canadian figure above is not a loose conversion. Each product's US dollar base is chosen so that the live conversion lands on the Canadian shelf price set for this market, and the result is pushed up to a whole dollar rather than left carrying cents, so one figure serves the page, the feed and every payment rail. See the shipping policy for carriers and cut-off times, and the legal position on research peptides in Canada for the regulatory picture.

What Is CJC-1295 DAC?

CJC-1295 DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) designed to enhance the release of growth hormone (GH) in research settings. It is characterized by the inclusion of a Drug Affinity Complex (DAC), which significantly extends its half-life, allowing for sustained GH release over an extended period. This modification is particularly advantageous in research focused on long-term modulation of the GH axis.

The peptide's design aims to mimic the natural pulsatile release of GH, which is crucial for its physiological effects. CJC-1295 DAC has been the subject of various studies exploring its potential applications in understanding growth hormone dynamics, muscle growth, and metabolic processes. However, it is important to note that CJC-1295 DAC is strictly for research purposes and not approved for human consumption.

CJC-1295 with DAC Mechanism of Action

CJC-1295 with DAC is a modified growth hormone releasing hormone analogue built on the GHRH(1-29) backbone, carrying four amino acid substitutions and, critically, a maleimidopropionyl group known as the Drug Affinity Complex. The four substitutions protect the peptide from enzymatic degradation, beginning with D-alanine at position 2, which blocks the dipeptidyl peptidase-4 cleavage that makes unmodified sermorelin short-acting.

The DAC moiety is what distinguishes this molecule from every other GHRH analogue. It is a reactive maleimide that forms a covalent bond with a free cysteine thiol on circulating albumin after administration. That bond is covalent rather than the reversible non-covalent binding used by acylated incretin analogues, which is why the resulting half-life is measured in days rather than hours and why the molecule produces a sustained elevation rather than a pulse.

At the receptor the molecule is a GHRH receptor agonist acting on pituitary somatotrophs through Gs and cyclic AMP. The pharmacologically important consequence of the DAC is not potency but exposure pattern: rather than a brief pulse of receptor activation, the somatotroph experiences continuous stimulation, which raises the question of receptor desensitisation and of whether sustained GHRH receptor activation reproduces the physiological pulsatile pattern or replaces it.

  1. Enzymatic protection

    Four substitutions on the GHRH(1-29) backbone, including D-alanine at position 2, block dipeptidyl peptidase-4 cleavage of the region required for receptor activation.

  2. Covalent albumin conjugation

    The maleimidopropionyl DAC group reacts with a free cysteine thiol on albumin to form a covalent bond, unlike the reversible fatty acid binding used by acylated incretin analogues.

  3. Extended circulation

    Covalent attachment to albumin gives a half-life reported on the order of six to eight days, producing sustained rather than pulsatile exposure.

  4. GHRH receptor agonism

    Agonism at the GHRH receptor on pituitary somatotrophs, signalling through Gs and cyclic AMP to trigger growth hormone release and synthesis.

  5. Sustained IGF-1 elevation

    The clinical study reported prolonged elevation of both growth hormone and insulin-like growth factor 1, which is the measurable consequence of continuous rather than pulsed receptor stimulation.

CJC-1295 with DAC Research Findings

The human evidence for this molecule is limited to early-phase work. Each entry names what was actually measured.

Prolonged elevation of growth hormone and IGF-1 in healthy adults

The key human study reported that single administrations produced sustained increases in growth hormone and insulin-like growth factor 1 concentrations lasting several days, establishing the pharmacodynamic consequence of covalent albumin binding.

Phase 1 trial

Half-life extension attributable to the DAC modification

The same work characterised the pharmacokinetics underlying the sustained effect, distinguishing this construct from GHRH analogues lacking the albumin-binding group, whose effects are measured in minutes to hours.

Phase 1 trial

Foundation of the position 2 substitution established separately

Earlier work incorporating D-alanine at position 2 of GHRH(1-29)NH2 demonstrated increased half-life and reduced metabolic clearance, which is the substitution this molecule inherits and builds upon.

Observational

Distinct receptor pathway from ghrelin receptor secretagogues

Reviews of the growth hormone and IGF-1 axis describe GHRH analogues and growth hormone secretagogues as acting on the same cell through different receptors, which is the mechanistic basis for studying them in combination.

Mechanistic

Absence of controlled efficacy evidence for musculoskeletal use

Structured reviews of injectable peptides in sports medicine and orthopaedics assess this compound among unapproved agents and consistently report no adequately powered human trials supporting the musculoskeletal or body composition uses discussed for it.

Observational

Endocrine context summarised in recent clinical reviews

Reviews of therapeutic peptides in endocrine and metabolic settings place the CJC-1295 family within the GHRH analogue class and summarise the limits of what has been demonstrated in humans.

Observational

CJC-1295 DAC Structure

CJC-1295 DAC Structure
BackboneHuman GHRH(1-29) with four amino acid substitutions
Key SubstitutionD-alanine at position 2, blocking DPP-4 cleavage
Conjugation GroupMaleimidopropionyl Drug Affinity Complex at the C-terminal lysine
Albumin BindingCovalent, via reaction with a free cysteine thiol on serum albumin
Molecular Weight3,367.9 g/mol
CAS Number863288-34-0
Also Known AsDAC:GRF, CJC-1295 DAC
Half-lifeReported on the order of 6 to 8 days
Receptor TargetGHRH receptor on pituitary somatotrophs
AppearanceWhite lyophilised powder
SequenceTyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Ser-Gln-Glu-Glu-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gly-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Ser-Ser-Ser
Molecular FormulaC152H252N44O42
PubChem CIDCID not available

Mechanism of Action

CJC-1295 DAC functions by binding to the growth hormone-releasing hormone receptor (GHRHR) on the pituitary gland, stimulating the release of growth hormone. The inclusion of the Drug Affinity Complex (DAC) in its structure allows for a prolonged half-life, which can exceed one week, as demonstrated in animal models. This extended half-life is achieved by reversible binding to serum albumin, which protects the peptide from rapid degradation.

Research indicates that this mechanism allows for a more sustained and physiologically relevant pattern of GH release, which is beneficial for studies aiming to replicate natural growth hormone secretion patterns. The ability to maintain elevated GH levels over extended periods without frequent dosing presents a significant advantage in experimental settings.

illustrate the mechanism by which CJC-1295 DAC stimulates GH release
Source: Honest Peptide

Pharmacokinetics and Stability

Studies have shown that CJC-1295 DAC exhibits a significantly longer half-life compared to traditional GHRH analogs due to its DAC modification. In rodent models, the half-life of CJC-1295 DAC has been reported to be approximately 8 days, which is substantially longer than that of non-DAC modified peptides. This prolonged duration of action is attributed to its ability to bind to albumin, reducing renal clearance and proteolytic degradation.

The stability of CJC-1295 DAC in biological systems makes it a valuable tool for research into sustained growth hormone release and its effects on various physiological processes. This stability ensures that the peptide remains active over the course of the study, providing consistent results.

Research on Growth Hormone Release

CJC-1295 DAC has been extensively studied for its ability to modulate growth hormone release in research models. Studies in rodents have demonstrated that administration of CJC-1295 DAC leads to a significant increase in circulating levels of GH and insulin-like growth factor 1 (IGF-1), which are critical mediators of growth and metabolism.

The peptide's ability to sustain elevated GH levels without the need for frequent administration makes it a promising candidate for studies investigating the long-term effects of GH on muscle growth, fat metabolism, and overall metabolic health. However, these findings are limited to preclinical models, and further research is needed to fully understand its potential applications.

Potential Applications in Research

The unique properties of CJC-1295 DAC make it a valuable tool for a variety of research applications. Its ability to promote sustained GH release has been utilized in studies exploring muscle hypertrophy, recovery, and metabolic regulation. In particular, research in animal models has shown potential benefits in enhancing muscle mass and reducing adiposity.

Additionally, CJC-1295 DAC is being investigated for its role in studying age-related changes in GH secretion and its impact on age-associated diseases. The peptide's long-acting nature provides a model for understanding the chronic effects of GH modulation, which could inform future research directions in endocrinology and metabolism.

The DAC Is the Molecule, Not an Accessory

CJC-1295 with DAC and CJC-1295 without DAC are routinely sold under the same name with a suffix, which understates how different they are. The peptide backbone is the same tetrasubstituted GHRH(1-29) sequence. The DAC version additionally carries a maleimidopropionyl group that reacts covalently with albumin after administration.

The consequence is not incremental. Reported half-lives differ by roughly two orders of magnitude: minutes to about half an hour for the version without DAC, six to eight days for the version with it. A difference of that scale changes the pharmacology qualitatively, not just its duration.

The covalent chemistry also differs from the acylation used by semaglutide and tirzepatide. Those bind albumin reversibly through a fatty acid, so free drug is continuously released and re-bound. A maleimide-thiol bond does not dissociate, so the conjugate persists for the lifetime of the albumin molecule it attached to.

Sustained Stimulation Versus the Physiological Pulse

Endogenous growth hormone secretion is episodic, with pulses separated by troughs, and the trough periods appear to matter for downstream receptor signalling rather than being merely the gaps between pulses.

A GHRH analogue with a multi-day half-life produces continuous receptor stimulation instead. Whether that reproduces the physiological effect of growth hormone or produces something pharmacologically different is a real and unresolved question, and it is the principal theoretical objection raised against this construct relative to short-acting analogues.

The human study reported sustained elevation of growth hormone and IGF-1, which establishes that the exposure pattern is achieved. It does not establish that sustained exposure is preferable to pulsatile exposure for any outcome.

Human Evidence and Regulatory Status

The human evidence consists principally of early-phase pharmacokinetic and pharmacodynamic work in healthy adults demonstrating sustained growth hormone and IGF-1 elevation. There are no adequately powered efficacy trials for any clinical outcome.

The compound has no marketing authorisation in any jurisdiction and appears on prohibited lists in competitive sport. Material supplied for research is for in-vitro laboratory use only and is not a medicine.

Handling and Analytical Considerations

The maleimide group is chemically reactive by design, which has practical consequences. It reacts with free thiols, so any reducing agent or thiol-containing buffer component will consume it, converting the molecule to a form that can no longer conjugate to albumin.

This makes buffer composition a matter of identity rather than only stability for this compound. It also means that a certificate reporting the mass of the unconjugated peptide is describing the material as supplied, which is the correct thing to report, but the reactive group's integrity is not something a mass alone confirms.

CJC-1295 with DAC Research FAQ

CJC-1295 DAC Summary

CJC-1295 DAC is a long-acting GHRH analog that has been extensively studied for its ability to modulate growth hormone release in research settings. Its unique DAC modification allows for sustained GH release, making it a valuable tool for studies on muscle growth, metabolism, and age-related changes in GH dynamics. However, it is important to emphasize that CJC-1295 DAC is strictly for research purposes and not intended for human use.

Article Author

Marcus Hopkin, PhD, is Director of Research and Development at Volta Peptides. He has more than 12 years of analytical chemistry experience, including peptide synthesis, characterization, purity testing and stability assessment.

Scientific Journal Author

Dr. Richard J. Ross is a leading expert in endocrinology, with a focus on growth hormone research and peptide therapeutics. His work has significantly advanced the understanding of peptide-based modulation of hormone release.

Scientific References

Primary literature and public trial registries only. No supplier or retailer pages are cited.

  1. 1Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adultsTeichman SL, Neale A, Lawrence B, et al. · Journal of Clinical Endocrinology and Metabolism · 2006
  2. 2Incorporation of D-Ala2 in growth hormone-releasing hormone-(1-29)-NH2 increases the half-life and decreases metabolic clearanceSoule S, King JA, Millar RP · Journal of Clinical Endocrinology and Metabolism · 1994
  3. 3The emerging landscape of performance-enhancing peptides modulating the GH-IGF1 axisDominikowski A, Rękoś Z, et al. · Frontiers in Endocrinology · 2026
  4. 4Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal InjuriesMendias CL, Awan TM, et al. · Sports Medicine · 2026
  5. 5Injectable Peptides in Sports Medicine: A Structured Narrative Review of Evidence and SafetyVillegas Meza AD, Nocek M, et al. · JBJS Reviews · 2026
  6. 6Therapeutic Peptides in Aesthetic, Metabolic and Endocrine Conditions: Effects, Safety and Clinical ApplicationsRenke G, Chinellato L, et al. · International Journal of Molecular Sciences · 2026

Referenced Citations

  1. 1Jasmin D. et al., Pharmacokinetics and Biological Activity of CJC-1295, Journal of Endocrinology, vol 198, pages 177-185, 2008.
  2. 2Teichman S.L. et al., Prolonged Stimulation of Growth Hormone by CJC-1295, Journal of Clinical Endocrinology & Metabolism, vol 91, pages 799-805, 2006.

Disclaimer

All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are furnished for in-vitro studies only. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease.

CJC-1295 DAC 5mg: frequently asked questions

Answered from the product record and the certificate file. Volta does not answer questions about administration, dosing or protocols.

What is supplied in a 5 mg vial of CJC-1295 DAC?

A sealed single-use vial containing 5 mg of CJC-1295 DAC as a lyophilized powder. Soluble in bacteriostatic water. No diluent, syringe or other supply is included.

Is CJC-1295 DAC supplied for human use?

No. For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Volta does not provide dosing, administration or protocol guidance for any material listed.

What purity is this CJC-1295 DAC released to?

>99% by HPLC. That figure is a release specification, a threshold Volta sets for every batch, and it is not the same kind of statement as a purity measured by a named laboratory for a named lot.

Is there a certificate of analysis for this CJC-1295 DAC vial?

A batch-specific Certificate of Analysis is available for this product on request. It is not published on the site yet: the batch history on the quality page lists the certificates already published, and this vial is covered by the release specification until its own is added there.

How is CJC-1295 DAC identified?

CAS 863288-34-0, molecular formula C₁₅₂H₂₅₂N₄₄O₄₂, molecular weight 3,367.9 g/mol. Those identifiers are what an incoming-goods check compares a certificate against, and they are stated here so the comparison can be made before ordering.

How should CJC-1295 DAC be stored before reconstitution?

Store at -20°C. Reconstitute in bacteriostatic water. After reconstitution, store at 2-8°C.

Where does this ship from?

British Columbia, Canada. Canadian orders are domestic, so they clear no customs and pay no import duty. International orders ship from the same facility.

CJC-1295 with DAC research

CJC-1295 with DAC is a GHRH analogue carrying a Drug Affinity Complex that binds serum albumin, which is what separates its multi-day half-life from the minutes of unmodified GHRH. Everything Volta publishes on this compound, across every vial size, is collected on what the Drug Affinity Complex changes.

CJC-1295 with DAC is one of the compounds in Volta's growth hormone research peptides catalogue, which collects the rest of the range studied in this area alongside the comparisons and guides that cover it.

More from the research catalogue

Every compound below has its own specification, batch number and certificate page, whether or not a vial is in stock today. Supplied for laboratory research use only.

Browse all growth hormone peptides

Your Cart

Your cart is empty

Browse our catalog to add research compounds.