Compound research hub
CJC-1295 with DAC: Research, Handling and Batch Documentation
CJC-1295 with DAC is a GHRH analogue carrying a Drug Affinity Complex that binds serum albumin, which is what separates its multi-day half-life from the minutes of unmodified GHRH.
Part of Volta's peptides.
Identity and specification
- Form
- Lyophilized powder
- Appearance
- White lyophilised powder
- Other known names
- CJC-1295 DAC, CJC-1295 with Drug Affinity Complex, DAC:GRF
- Compound class
- GHRH analogue (GHRH receptor agonist)
- Sequence, one-letter
- YADAIFTQSYRKVLASQEEKSARKLLQDIMSRGRRKGSTFSSS
- Sequence, three-letter
- Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Ser-Gln-Glu-Glu-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gly-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Ser-Ser-Ser
- Residues
- 43
- CAS number
- 863288-34-0
- Molecular formula
- C₁₅₂H₂₅₂N₄₄O₄₂
- Molecular weight
- 3,367.9 g/mol
- Production
- Synthetic, by solid-phase peptide synthesis
- Solubility
- Soluble in sterile water
- Shelf life
- 24 months from date of manufacture
Molecular structure, sequence and the published laboratory studies on CJC-1295 with DAC are in the compound library entry for CJC-1295 with DAC.
Vial sizes available
Every size of CJC-1295 with DAC Volta lists, in stock or not. Each is a separate catalogue page with its own batch number and specification table.
- Restocking
CJC-1295 DAC 5mg 5mgBatch #: VPCD5100
Purity and batch documentation
Volta's release specification is >99% (HPLC). That is a threshold we set. >99% is the specification every batch is released to. The figure on a certificate is what a laboratory measured for one lot.
No third-party certificate has been published for CJC-1295 with DACyet. The certificates Volta does publish, with the laboratory's own verification link on each, are in the certificate archive.
Research on CJC-1295 with DAC
Handling and stability
Laboratory guides
Regulatory context
More peptides
CJC-1295 with DAC sits in Volta's peptides group, alongside the other compounds of the same composition. The whole range is on the full research catalogue, and the library of comparisons and guides is under peptide research.