
Cagrilintide 10mg Peptide
For in-vitro laboratory research only. Not for human or animal administration.
Batch #: VPCG10100
Get Notified When Available
This product is currently out of stock. Enter your email and we'll notify you the moment it's back.
Research Use Only
For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Batch-specific Certificates of Analysis available for all products.
Cagrilintide 10mg: overview
What the vial contains and what the material is, stated as specifications rather than as outcomes.
Cagrilintide supplied as a lyophilized powder in a sealed single-use vial containing 10 mg of material. Cagrilintide: molecular formula C₁₉₄H₃₁₂N₅₄O₅₉S₂, molecular weight 4,409.08 g/mol, CAS 1415456-99-3. Released to a specification of >99% purity by HPLC. Soluble in bacteriostatic water. Supplied for in-vitro laboratory research only. Not a drug, food or supplement. Not for human or veterinary use.
Volta does not provide dosing, administration or protocol guidance for any material listed.
Cagrilintide 10mg specifications
Every field the product record holds. A field with no value is omitted rather than printed as a dash.
- Fill
- 10mg
- Form
- Lyophilized powder
- CAS number
- 1415456-99-3
- Molecular formula
- C₁₉₄H₃₁₂N₅₄O₅₉S₂
- Molecular weight
- 4,409.08 g/mol
- Solubility
- Soluble in bacteriostatic water
- Shelf life
- 24 months from date of manufacture
Cagrilintide analytical verification and batch documentation
What the purity figure on this page is, who measured what, and which of the two a reader is looking at.
Specification. Every batch is released to >99% purity by HPLC. That is a threshold Volta sets, and it is a promise rather than a measurement.
Measurement. No certificate for this compound is published on the site yet. A batch-specific Certificate of Analysis is available on request, and the batch history lists the ones already published. Until one is published for this material, the figure above is the release specification and nothing on this page is a laboratory result.
Checking a certificate. The batch number printed beside the price is derived from the compound code and the vial strength; the lot number on a certificate is transcribed from the document. They are produced independently, so comparing them is a real check. How to read one is set out in the quality and testing methodology page.
For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease.
Native amylin is co-secreted with insulin and signals meal termination, but it aggregates readily and clears quickly, which is why analogue design has focused on solubility and half-life. Cagrilintide addresses both through acylation, giving a duration suitable for weekly administration in published protocols. Its dual amylin and calcitonin receptor activity distinguishes it from selective agonists such as eloralintide, and comparing the two is a common experimental design. This 10mg vial supports receptor-binding assays and combination work alongside GLP-1 agonists.
- Released to a >99% purity specification by HPLC
- Lyophilized powder, 10mg per vial
- Soluble in bacteriostatic water
- For laboratory research use only
Frequently Bought Together

Cagrilintide 10mg
10mg
$71 USD
Bundle & Save
$168 USD
Save $8.40 USD
$231 USD
Save $23.10 USD
$280 USD
Save $42 USD
$364 USD
Save $72.80 USD
Click any product above to toggle selection
Cagrilintide 10mg: what is in the vial
The arithmetic specific to this 10mg vial, and what a milligram of Cagrilintide costs in each strength the catalogue carries. Concentrations are stated, not recommended.
Vial contents
10 mg
Lyophilised powder, reconstituted by the buyer
Cost of material
$7.10 / mg USD
CA$10.20 / mg in Canadian dollars
Concentration at each diluent volume
10 mg of dry material reaches these concentrations in the volumes below. A U-100 syringe marking is 0.01 ml by definition, so the last column is a unit conversion at each concentration rather than a quantity to use.
| Diluent added | Concentration | In 0.1 ml | Per U-100 unit |
|---|---|---|---|
| 1 ml | 10 mg/ml | 1 mg | 100 mcg |
| 2 ml | 5 mg/ml | 500 mcg | 50 mcg |
| 3 ml | 3.33 mg/ml | 333.3 mcg | 33.3 mcg |
| 5 ml | 2 mg/ml | 200 mcg | 20 mcg |
For a volume this table does not list, the reconstitution calculator takes any vial size and diluent volume.
Cagrilintide by the milligram
The same compound in every strength the catalogue carries, priced per milligram of material so the vials are comparable. Larger is not automatically cheaper.
| Vial | Price USD | Per mg USD | Per mg CAD |
|---|---|---|---|
| 5mg | $57 | $11.40 | CA$16.40 |
| 10mgthis pageout of stock | $71 | $7.10 | CA$10.20 |
The 10mg vial is the cheapest material in this range at $7.10 per mg, which is this page.
Per-unit figures are quoted in US and Canadian dollars so the vials stay comparable against each other. The price you are charged is the one in the currency selected at the top of the page, and it is converted from the same US dollar base as the figures here.
Cagrilintide purity and identity: how the figure is measured
What >99% (HPLC) means, the masses an identity check has to land on, and the entries that make a certificate of analysis checkable rather than decorative.
Stated purity
>99% (HPLC)
Area percent of the main peak by reversed-phase HPLC
Average mass
4,409.08 g/mol
The figure an identity check has to land on
Identity by mass: the ions to expect
An electrospray source protonates the molecule rather than weighing it neutral, so a spectrum shows a series of charge states rather than the molecular weight itself. These are the m/z values 4,409.08 g/mol produces, and they are what a mass spectrum on a certificate for Cagrilintide has to match.
| Ion | Charge | Expected m/z |
|---|---|---|
| [M+H]+ | 1+ | 4,410.09 |
| [M+2H]2+ | 2+ | 2,205.55 |
| [M+3H]3+ | 3+ | 1,470.70 |
A peptide this size is normally reported at its doubly and triply charged states, and the singly charged ion may not appear at usable intensity at all. A spectrum showing only one of these is not a failed identity check.
What a certificate for Cagrilintide should carry
A purity percentage on its own is not checkable. These are the entries that make one verifiable, and their absence is the most common weakness in a research-peptide certificate.
The chromatogram, not only the number
A stated area percent with no trace behind it cannot be read for the shape of the main peak or for what eluted beside it. The HPLC interpreter walks through what a trace shows.
Net peptide content, separately from gross mass
A lyophilised peptide is a salt, usually of trifluoroacetic or acetic acid, plus residual water. The vial's stated milligrams are gross; net peptide content is the fraction of that mass which is the molecule. The two differ by ten to twenty percent routinely, and only one of them is what the price is per milligram of. The net peptide content calculator converts between them.
The counterion, named
Which salt form the powder is in changes the net content and the pH the powder dissolves at. A certificate that never names it leaves both unknowable.
Water content, by a stated method
Loss on drying and Karl Fischer titration give different numbers, and a water figure with no method attached cannot be compared with anyone else's.
A laboratory and a report identifier
Without both, nothing on the document can be traced back to the laboratory that issued it. The red flag checker lists the rest.
Batch certificates are published as page images in the certificate library. The source PDFs are never served: a certificate is the most forgeable document a supplier publishes, and an editable copy carrying an accredited laboratory's letterhead is worth more to a counterfeiter than to a customer.
Cagrilintide storage and stability
Handling as the product record states it, followed by the degradation chemistry this particular sequence is and is not exposed to.
Handling
Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.
What degrades this compound
Each of these follows from the molecule itself rather than from general peptide handling.
Interfacial and surface loss
4,409.08 g/mol, above the 3,500 g/mol range where this dominatesA peptide this size unfolds at boundaries. It adsorbs to glass and to polypropylene, and it denatures at the air-water interface that shaking creates, which is why a vial is swirled rather than vortexed and why the diluent is run down the vial wall instead of squirted onto the powder. The failure is quiet: interfacial loss removes material without changing what is left behind, so the solution still assays clean at a concentration lower than the arithmetic says.
Cagrilintide compared with Retatrutide and Tirzepatide
Pharmacological class, half-life, evidence grade, competition status and cost per milligram, side by side.
| Compound | Class | Half-life | Evidence | WADA | Cheapest per mg |
|---|---|---|---|---|---|
| Cagrilintidethis page | Metabolic / Amylin Analog | ~7 days (allows once-weekly dosing) | BPhase III / NDA Filed | Not listed | $11.405mg vial |
| Retatrutide | Metabolic / Triple Agonist | ~6 days (allows once-weekly dosing) | BPhase III / NDA Filed | Not prohibited | $4.8520mg vial |
| Tirzepatide | Metabolic / Dual GIP-GLP-1 Agonist | ~5 days (116 hours) | AFDA Approved | Not prohibited | $2.9730mg vial |
| 5-Amino-1MQ | Metabolic / Fat Loss | Unknown in humans; estimated hours based on animal PK | DAnimal/Preclinical Only | Not listed | $4.3010mg vial |
| Semaglutide | Metabolic / GLP-1 Agonist | ~160–168 hours (~7 days) | AFDA Approved | Not prohibited | $4.2020mg vial |
Evidence grades and half-lives are as recorded in the compound database, which cites its own sources on each compound page. Per-milligram prices are the cheapest strength each compound is currently listed at, in US dollars, and an out-of-stock note means that figure is not purchasable today. Cross-trial comparisons of efficacy are not comparisons: no head-to-head trial exists for most of these pairs.
Cagrilintide in Canada
Price in Canadian dollars, where the parcel ships from, and how long it takes.
Price in CAD
CA$102
The figure charged, not a converted estimate
Ships from
British Columbia
A domestic parcel, so no import clearance step
Transit
2 to 5 business days
After 1 to 2 business days of handling
Free standard shipping
Over CA$250
A bar set for this market, not converted from the US one
Cagrilintide 10mg ships from British Columbia to Canadian addresses, so the parcel never crosses a border. That removes the failure a Canadian buyer of research peptides is usually weighing: an inbound international shipment can be held for import clearance or seized, and a domestic one has no clearance step to be held at.
Shipping is quoted live against the delivery address at checkout rather than estimated here, and both the standard and express tiers show their price and transit window before a payment method is chosen. The figure the page shows is the figure the rail charges: all three settlement rails price shipping through the same functions the quote does.
The Canadian figure above is not a loose conversion. Each product's US dollar base is chosen so that the live conversion lands on the Canadian shelf price set for this market, and the result is pushed up to a whole dollar rather than left carrying cents, so one figure serves the page, the feed and every payment rail. See the shipping policy for carriers and cut-off times, and the legal position on research peptides in Canada for the regulatory picture.
What is Cagrilintide?
Cagrilintide is a 37 residue analogue of human amylin carrying a C20 fatty diacid on the N-terminal lysine. Novo Nordisk developed it under the codes AM833 and NNC0174-0833, and Kruse and colleagues published the design work in the Journal of Medicinal Chemistry in 2021, where the molecule appears as analogue 23. It is the amylin half of the fixed combination with semaglutide that the sponsor calls CagriSema.
Amylin is co-secreted with insulin from pancreatic beta cells and acts on receptors in the area postrema and other circumventricular structures to end a meal. It is a poor drug on its own for a specific chemical reason: human amylin aggregates into amyloid fibrils, and the same beta-sheet propensity that builds islet amyloid in type 2 diabetes destroys a formulated solution. The only marketed amylin analogue before cagrilintide, pramlintide, solved aggregation but not clearance, and clears with a half-life of roughly 20 to 45 minutes.
Cagrilintide addresses both problems in one molecule. Six substitutions relative to human amylin suppress fibril formation and stabilise the central helix, and the acylation drives reversible albumin binding that pushed the reported human half-life to 159 to 195 hours. It is not selective for amylin receptors: cryo-electron microscopy structures published in 2025 show it engaging AMY1R, AMY2R, AMY3R and the bare calcitonin receptor, and that lack of selectivity is a deliberate design feature rather than an impurity of the pharmacology.
This 10mg vial is supplied as a lyophilised powder for in vitro and preclinical laboratory research. It is not the clinical fixed-dose formulation, and nothing on this page is guidance for use in a person.
Cagrilintide Mechanism of Action
Amylin receptors are not standalone proteins. They are heterodimers of the class B1 G protein-coupled calcitonin receptor (CTR) with one of three receptor activity-modifying proteins: CTR plus RAMP1 gives AMY1R, CTR plus RAMP2 gives AMY2R, and CTR plus RAMP3 gives AMY3R. CTR also reaches the cell surface without any RAMP, where it responds potently to calcitonin peptides and only weakly to amylin. Cagrilintide is an agonist at all four, and the 2025 cryo-electron microscopy work from Cao and colleagues resolved Gs-coupled complexes of cagrilintide with each one at 2.2 A for CTR, 2.2 A for AMY1R, 2.7 A for AMY2R and 3.0 A for AMY3R.
The structural basis for that breadth sits at the C-terminus. In rat amylin, the amidated Tyr37 contacts the RAMP extracellular domain, which is part of why amylin needs a RAMP to bind well. Cagrilintide replaces it with proline, mirroring Pro32 of salmon calcitonin. In the cagrilintide-bound AMY1R and AMY3R structures the small Pro37 side chain is buried entirely by calcitonin receptor extracellular domain residues, packing against Trp79 with no direct contact to RAMP1 or RAMP3 at all. That single change is why cagrilintide forms high-affinity interactions with the CTR protomer on its own.
The N-terminal region does the receptor activation. Cagrilintide forms the same bypass motif that gives amylin analogues their potency at AMY receptors, anchored by van der Waals packing between Phe23 of the peptide and Tyr146 and Tyr149 in transmembrane helix 1 of the receptor. The paired N14E and V17R substitutions form an intramolecular salt bridge across one face of the helix spanning residues 5 to 18, seen in a crystal structure of the non-lipidated backbone fused to maltose binding protein (PDB 7BG0), and that helix stabilisation is what suppresses the beta-sheet conversion that drives fibrillation.
Lipidation is not pharmacologically silent. Comparing cagrilintide with its non-lipidated backbone in a cAMP response element reporter assay, the two had similar potency and maximal response in cells co-expressing CTR and RAMP3, but the non-lipidated peptide lost potency at CTR expressed alone. The authors attribute this to the gamma-glutamyl linker forcing a different rotamer of His296 in extracellular loop 2 and a more open extracellular loop 3, so the fatty acid arm contributes to CTR engagement as well as to albumin binding and slow clearance.
Albumin binding
The C20 alpha,omega-diacid on Lys1 binds serum albumin reversibly, which is what turns a peptide that would clear in minutes into one with a reported plasma half-life of 159 to 195 hours in the phase 1b trial.
Receptor engagement
Cagrilintide binds the shared C-terminal groove of the calcitonin receptor extracellular domain, with Pro37 buried against Trp79 rather than reaching for a RAMP. This gives measurable activity at AMY1R, AMY2R, AMY3R and CTR alone.
Gs coupling and cAMP
All four resolved complexes are Gs-coupled. Agonism is read out as cAMP accumulation, and the non-lipidated backbone shows that the lipid arm alters extracellular loop conformation in a way that matters for CTR but not for CTR plus RAMP3.
Hindbrain satiation signalling
Amylin receptors are dense in the area postrema, a circumventricular organ outside the blood-brain barrier. Hay and colleagues review the rodent and human evidence that amylin acting there ends a meal and interacts functionally with cholecystokinin, leptin and estradiol signalling.
Delayed gastric emptying and glucagon suppression
The classical peripheral amylin actions catalogued in the pharmacology literature: slowed gastric emptying and suppression of postprandial glucagon, both of which contribute to the glucose effects seen with amylin analogues.
Cagrilintide Key Benefits
Each entry names the model the observation came from. Nothing here is an outcome claim for a reader.
Dose-dependent body-weight reduction as a single agent
In the 26 week phase 2 dose-finding trial (NCT03856047, 706 participants on cagrilintide across five dose groups at 57 sites in ten countries), mean weight reduction ranged from 6.0% to 10.8% across the 0.3 mg to 4.5 mg once-weekly groups versus 3.0% on placebo. The 4.5 mg group also separated from once-daily liraglutide 3.0 mg (10.8% versus 9.0%, estimated treatment difference 1.8%, p=0.03).
Phase 2 trialAdditive effect on top of a GLP-1 receptor agonist
In the phase 1b multiple-ascending-dose trial (NCT03600480, 95 exposed participants), cagrilintide 1.2 mg and 2.4 mg given alongside semaglutide 2.4 mg produced 15.7% and 17.1% mean weight reduction at week 20 against 9.8% for pooled placebo plus semaglutide, estimated treatment differences of -6.0% and -7.4%.
Phase 1 trialConfirmed in a 3417 participant phase 3a trial
REDEFINE 1 (NCT05567796) randomised participants without diabetes to cagrilintide-semaglutide 2.4 mg each, semaglutide alone, cagrilintide alone or placebo for 68 weeks. Mean body-weight change under the treatment-policy estimand was -20.4% for the combination, -14.9% for semaglutide alone, -11.5% for cagrilintide alone and -3.0% for placebo.
Phase 3 trialGlycaemic effect distinguishable from the GLP-1 arm
In the 32 week phase 2 trial in type 2 diabetes (NCT04982575, n=92), HbA1c fell 2.2 percentage points on the combination, 1.8 on semaglutide alone and 0.9 on cagrilintide alone. Cagrilintide alone therefore moved HbA1c, but roughly half as far as the GLP-1 comparator, while producing more weight change than it (-8.1% versus -5.1%).
Phase 2 trialSustained appetite suppression in rodents from a single administration
The development paper reports that analogue 23, the compound selected as cagrilintide, reduced food intake in rats for several days after a single administration in the 1 to 10 nmol/kg range, consistent with the extended exposure the acylation was designed to produce.
Rodent modelA resistance to amyloid fibrillation that native amylin does not have
The N14E and V17R salt bridge plus the A25P, S28P and S29P prolines were selected specifically to block the beta-sheet conversion that makes human amylin unusable as a formulated peptide. The salt bridge is visible in the crystal structure of the non-lipidated backbone (PDB 7BG0) and is preserved in every active-state receptor complex resolved in 2025.
MechanisticNo clinically relevant effect on cardiac repolarisation
A dedicated thorough QT study (NCT05804162, 105 healthy participants) escalated cagrilintide to 4.5 mg once weekly and measured Fridericia-corrected QT at 12, 24, 48 and 72 hours after the final administration. The upper bound of the two-sided 90% confidence interval for the placebo-adjusted change stayed below 10 ms at all four timepoints, with moxifloxacin confirming assay sensitivity.
Phase 1 trialCagrilintide Molecular Information
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (37 residues, C-terminal amide) |
| Substitutions vs Human Amylin | N14E, V17R, A25P, S28P, S29P, Y37P |
| Lipidation | C20 alpha,omega-diacid (icosanedioic acid) coupled through a gamma-glutamyl spacer to the alpha-amino group of Lys1 |
| Disulfide Bond | Cys2 to Cys7 (written as the 3 to 8 bridge in CAS nomenclature, which counts the gamma-Glu spacer as the first residue) |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409.01 g/mol average (free acid); 4406.25 Da monoisotopic |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| UNII | AO43BIF1U8 |
| Development Codes | AM833, NNC0174-0833 |
| Receptor Targets | AMY1R (CTR + RAMP1), AMY2R (CTR + RAMP2), AMY3R (CTR + RAMP3) and CTR alone |
| Reported Plasma Half-life | 159 to 195 hours across the 0.16 mg to 4.5 mg range in the phase 1b trial |
| Des-acyl Backbone Mass | C169H269N53O53S2, about 3955.4 g/mol; the gamma-Glu plus C20 diacid arm accounts for the remaining 453.6 Da |
| Salt Form | Commonly supplied as the acetate salt (PubChem CID 164618153); the counterion adds mass without altering the peptide |
| Physical Form | Lyophilised white powder, research use only |
Cagrilintide Structure and the Amyloid Problem It Was Built to Solve
Human amylin has one dominant liability as a drug candidate, and it is not potency. The peptide converts readily to beta-sheet-rich amyloid fibrils, the same process that deposits islet amyloid in type 2 diabetes pancreas, and a peptide that fibrillates in the vial is not a formulation. Kruse and colleagues opened their 2021 development paper by naming this as the central design constraint, and the six substitutions in cagrilintide split cleanly into two functional groups aimed at it.
The first group is A25P, S28P and S29P. These are the three proline substitutions that already exist in rat amylin, which does not fibrillate, and they are the same three that define pramlintide. Proline is a helix and sheet breaker; putting three of them into the C-terminal half of the peptide removes the segment most prone to beta-sheet stacking. The second group is the paired N14E and V17R, which are not in pramlintide. Positioned three residues apart on the same helical face, the glutamate and arginine side chains form an intramolecular salt bridge that stabilises the alpha-helix spanning residues 5 to 18. A crystal structure of the non-lipidated cagrilintide backbone fused to maltose binding protein (PDB 7BG0) shows the bridge, and every active-state receptor structure solved in 2025 shows it preserved with the two side-chain rotamers constrained.
The sixth substitution, Y37P, does something different. It is a potency and selectivity change rather than a stability one, and it is discussed in the receptor pharmacology section below. Separately from all six, the C20 alpha,omega-diacid attached through a gamma-glutamyl spacer to the alpha-amino group of Lys1 is the pharmacokinetic element: it is the same acylation logic used in semaglutide, exploiting reversible albumin binding to slow renal filtration and proteolysis.
The result is a molecule with a substantially different physical character from native amylin. Where the parent hormone aggregates, cagrilintide holds a stable helix. Where the parent hormone clears in minutes, cagrilintide showed a half-life of 159 to 195 hours in humans across a 28-fold dose range, with exposure proportional to dose and a median time to maximum concentration of 24 to 72 hours.
Cagrilintide Receptor Pharmacology: Why Non-Selectivity Was the Point
The amylin receptor family is unusual. There is no dedicated amylin receptor gene. Instead the calcitonin receptor, a class B1 GPCR, partners with receptor activity-modifying proteins to change its own pharmacology: with RAMP1 it becomes AMY1R, with RAMP2 AMY2R, with RAMP3 AMY3R, and without any RAMP it stays a calcitonin receptor that responds well to calcitonin peptides and poorly to amylin. A ligand's profile across those four states is therefore a design choice, not a fixed property of the target.
For years the working assumption in the field was that the amylin receptor phenotypes carried the weight effects, since a calcitonin-receptor-selective agonist does not control appetite or body weight in animals. The awkward observation is that dual CTR and AMY receptor agonists, salmon calcitonin among them, report higher efficacy than AMY-selective agonists. Cagrilintide was taken forward as a dual agonist on that reasoning.
In 2025 Cao and colleagues at Monash, working with Novo Nordisk, determined Gs-coupled cryo-electron microscopy structures of cagrilintide at all four receptor states: 2.2 A for CTR, 2.2 A for AMY1R, 2.7 A for AMY2R and 3.0 A for AMY3R. The receptors were co-expressed with a dominant-negative Gs and stabilised with nanobody 35. The comparison with rat amylin and salmon calcitonin complexes localises the non-selectivity to a single residue. Rat amylin's amidated Tyr37 reaches into the RAMP extracellular domain and forms the only direct peptide contact with the RAMP in previously reported complexes. Cagrilintide's Pro37 does not: it is buried by calcitonin receptor extracellular domain residues, forming extensive hydrophobic contacts with Trp79 and making no direct interaction with RAMP1 in AMY1R or RAMP3 in AMY3R. That is the structural reason cagrilintide can bind the CTR protomer alone with high affinity, and it is exactly the behaviour of Pro32 in salmon calcitonin.
The paper's own summary of the result is that cagrilintide adopts an amylin-like binding mode but induces distinct conformational dynamics at calcitonin-family receptors relative to rat amylin, salmon calcitonin and newer amylin-based peptides. For in vitro receptor work this is the practically useful point: a cagrilintide dose-response curve run only in an AMY3R line describes a fraction of the molecule's pharmacology, and comparing it against a selective amylin agonist requires including a RAMP-free CTR arm to see the difference at all.
Cagrilintide Clinical Trial Programme, Phase 1 Through Phase 3
The human dataset arrived in a specific order and each stage answered a different question. The phase 1b trial (NCT03600480) ran six sequential overlapping cohorts at a single US site between July 2018 and December 2019, randomising 96 participants with a body-mass index of 27.0 to 39.9 kg/m2 in a 3:1 ratio to cagrilintide at 0.16, 0.30, 0.60, 1.2, 2.4 or 4.5 mg once weekly or matched placebo, all on a background of semaglutide 2.4 mg once weekly. Its primary endpoint was treatment-emergent adverse events, and its most cited output is pharmacokinetic: cagrilintide exposure was dose-proportional, area under the curve over 168 hours ran from 926 to 24271 nmol x h/L, and cagrilintide did not alter semaglutide exposure or elimination.
The phase 2 dose-finding trial (NCT03856047) was the monotherapy readout: 706 participants on cagrilintide, 99 on liraglutide 3.0 mg and 101 on placebo, 26 weeks of treatment with an escalation period of up to six weeks, run across ten countries. Weight reduction was 6.0% to 10.8% on cagrilintide against 3.0% on placebo, with the 4.5 mg group beating daily liraglutide. Gastrointestinal events were the dominant tolerability signal, reported by 41% to 63% of cagrilintide participants against 32% on placebo, mostly nausea (20% to 47% versus 18%).
The 32 week phase 2 trial in type 2 diabetes (NCT04982575) is the only randomised comparison of cagrilintide alone, semaglutide alone and the combination in the same protocol, at 92 participants. It produced the cleanest separation of the two mechanisms in humans: on weight, cagrilintide alone outperformed semaglutide alone (-8.1% versus -5.1%); on HbA1c, semaglutide alone outperformed cagrilintide alone (-1.8 versus -0.9 percentage points). The combination led on both.
The phase 3a REDEFINE programme followed. REDEFINE 1 (NCT05567796) enrolled 3417 adults without diabetes for 68 weeks in a 21:3:3:7 randomisation, and REDEFINE 2 (NCT05394519) enrolled 1206 adults with type 2 diabetes and an HbA1c of 7% to 10% for the same duration. Both were published in the New England Journal of Medicine in 2025. REDEFINE 2 reported -13.7% body weight on the combination against -3.4% on placebo, with 73.5% of the combination group reaching an HbA1c at or below 6.5% against 15.9% on placebo. Gastrointestinal adverse events dominated the safety profile in both trials, affecting 79.6% of the REDEFINE 1 combination group and 72.5% of the REDEFINE 2 combination group.
The programme has also produced a negative result worth stating plainly, because it is routinely omitted. REDEFINE 4 compared the fixed combination against tirzepatide 15 mg once weekly over 84 weeks and did not meet its non-inferiority threshold for weight reduction: 23.0% versus 25.5% under the efficacy estimand, 20.2% versus 23.6% under the treatment-regimen estimand. The dedicated cardiovascular outcomes trial, REDEFINE 3, is event-driven in roughly 7000 adults with established cardiovascular disease and has not reported, so no statement about major adverse cardiovascular events can be made from this programme yet.
Cagrilintide Versus Semaglutide and Retatrutide: Amylin Against Incretin Pharmacology
These compounds share a catalogue category and almost nothing else at the receptor. Semaglutide is a selective agonist at the GLP-1 receptor, a class B1 GPCR expressed in pancreatic beta cells, the hypothalamic arcuate nucleus and the nodose ganglion. Retatrutide is a triple agonist at the GIP, GLP-1 and glucagon receptors, all three in the same glucagon receptor subfamily. Cagrilintide targets the calcitonin receptor and its three RAMP heterodimers, a different subfamily of class B1 entirely, and reaches the brain principally through the area postrema rather than the arcuate.
The functional consequence shows up in the human data. In the head-to-head arms of the 32 week type 2 diabetes trial, cagrilintide alone produced more weight change than semaglutide alone (-8.1% versus -5.1%) and less HbA1c change (-0.9 versus -1.8 percentage points). Amylin agonism is therefore not a weaker version of incretin agonism; it moves body weight efficiently while moving glycaemia comparatively little, which is what you would expect from a satiation signal acting on meal termination rather than an insulinotropic hormone acting on beta cells.
Because the pathways are separate, their effects add rather than overlap. REDEFINE 1 measured all three arms in one protocol at 68 weeks: -11.5% on cagrilintide alone, -14.9% on semaglutide alone, -20.4% on the combination against -3.0% on placebo. A strictly additive model, subtracting the placebo effect once, would predict about 23.4%; the observed 20.4% falls short of that, so the two mechanisms combine sub-additively rather than synergistically. The combination still gained 5.5 percentage points over semaglutide alone, which is the number the programme was built on.
One asymmetry is worth noting for experimental design. Gastrointestinal adverse events were reported in 79.6% of the REDEFINE 1 combination group, and both classes drive them, so tolerability is not additive in the direction anyone wants. A phase 1 trial currently recruiting (NCT07607587) is specifically evaluating cagrilintide in participants who could not tolerate GLP-1 receptor agonists because of gastrointestinal adverse events, which is a direct test of whether the two mechanisms produce gastrointestinal effects through separable circuits.
Cagrilintide Versus Pramlintide and the Selective Amylin Agonists
Pramlintide is the closest structural relative and the comparison is precise: pramlintide is human amylin with A25P, S28P and S29P. Cagrilintide carries those same three prolines plus N14E, V17R and Y37P plus the Lys1 acylation. Three substitutions and one lipid chain separate a peptide that clears in roughly 20 to 45 minutes from one with a reported half-life of 159 to 195 hours, and separate a selective amylin receptor agonist from one that also engages the bare calcitonin receptor. Pramlintide was approved in the United States in 2005 as an adjunct to insulin, was never brought to the EU, Canada or Australia, and produces modest weight change in trials.
At the other end sits the selective amylin analogue class. Novo Nordisk's own NN1213, described by Dahl and colleagues in 2024, was optimised explicitly for selectivity as well as solubility, stability and clearance; in obese rats, daily administration over 21 days produced dose-dependent body-weight reduction that magnetic resonance imaging attributed primarily to fat mass loss. Eloralintide, from a separate programme and also stocked in this catalogue, belongs to the same selective lane.
The unresolved question the field is actually arguing about is whether calcitonin receptor co-agonism helps or is baggage. The structural paper states the tension directly: a calcitonin-receptor-selective agonist does not control appetite or body weight, which argues the amylin receptors carry the effect, yet dual CTR and AMY receptor agonists report higher efficacy than AMY-selective agonists, which argues co-activation contributes something. Because cagrilintide and a selective agonist differ at a small number of positions, the pair is a usable in vitro tool for that question: run both across CTR alone and CTR plus each RAMP and the selectivity difference is directly measurable in a cAMP readout.
Cagrilintide Stability, pH Sensitivity and Laboratory Handling
Cagrilintide is more fibrillation-resistant than human amylin, not immune to it, and the difference matters in the laboratory. The entire substitution strategy in the molecule exists to raise the energy barrier to beta-sheet conversion, and that barrier is pH dependent for the same reason it is in the parent hormone: amylin-family peptides aggregate fastest near neutral pH, where the peptide sits closest to its isoelectric point and charge repulsion between molecules is weakest. Pharmaceutical formulation of this class accordingly sits in a mildly acidic window rather than at physiological pH.
In practice that makes the diluent choice a chemistry decision rather than a formality. A solution buffered near neutrality does not destroy the peptide immediately, but it puts it in the pH region where deamidation of the several asparagine and glutamine residues in the sequence proceeds fastest and where aggregation kinetics are least favourable. The sequence carries five asparagines, at positions 3, 21, 22, 31 and 35, plus a single glutamine at position 10. It contains no Asn-Gly, the fastest-deamidating motif in peptide chemistry, but it does carry Asn-Thr at 3 to 4 and again at 35 to 36, which sit one rank below Asn-Gly for succinimide formation and are the residues an accelerated stability study on this molecule should be watching.
Two failure modes are visible without instrumentation. Cloudiness or visible particulate in a solution that was clear indicates aggregation, and freeze-thaw cycling is the usual cause: ice-front cryoconcentration and the expanding ice-water interface both nucleate the beta-sheet conversion. Neither can be reversed. The lyophilised powder is far more stable than any solution, which is why the material ships lyophilised and why analytical work on stability should be dated from the point the powder is dissolved rather than from receipt.
One piece of received wisdom about handling this class is worth correcting, because it is repeated widely and it is wrong. Vigorous agitation is genuinely bad for an amylin analogue, but not because it breaks the disulfide bond. A carbon-sulfur or sulfur-sulfur covalent bond is not broken by shaking a vial; disulfides are cleaved by reducing agents, by thiol-disulfide exchange at alkaline pH, or by photolysis, none of which shaking supplies. What agitation actually does is generate air-water interface, and the hydrophobic face of an amphipathic peptide adsorbs to that interface, partially unfolds there and nucleates fibrils. The correct handling conclusion is the same, swirl rather than vortex, but the mechanism matters because it also explains why headspace, surfactant content and repeated pipetting change the outcome while bond chemistry has nothing to do with it.
There is one further consideration specific to acylated peptides. The C20 diacid gives cagrilintide surfactant-like behaviour, so it adsorbs to glass and to some plastics at low concentration. In binding assays and in dilution series run at nanomolar concentrations this is a real source of apparent potency loss, and it is the reason carrier protein is commonly included in assay buffers for lipidated peptides.
Cagrilintide Analytical Characterisation
Identity for a molecule of this shape is established on mass first. The calculated average mass is 4409.01 g/mol for C194H312N54O59S2, with a monoisotopic mass of 4406.25 Da. On electrospray ionisation the peptide presents as a charge envelope rather than a single ion, typically in the 4+ to 6+ range, and deconvolution should return the intact mass within a few daltons.
Two specific mass results carry most of the diagnostic value, and both are consequences of how the molecule is built. A deconvoluted mass near 3955 Da rather than 4409 Da is the unacylated backbone: subtract the gamma-glutamyl spacer and the C20 diacid, together C25H43NO6, from the full formula and C169H269N53O53S2 at 3955.4 Da is what remains. A 453.6 Da deficit therefore means the acylation step failed, and since the acyl arm is the entire basis of the extended half-life, that material is pharmacologically a different compound. Separately, a result 2 Da high indicates a reduced open-chain species where the Cys2 to Cys7 disulfide has not closed, which is the other common structural defect in a synthesis of this class.
Purity is assessed by reversed-phase HPLC, and the acylation dominates the retention behaviour. The C20 diacid makes cagrilintide markedly more hydrophobic than an unmodified 37-mer of similar composition, so it elutes late in an acetonitrile gradient and the informative impurities are the ones that elute near it: the des-acyl backbone, which is far more polar and comes off substantially earlier, and truncation products from incomplete couplings, which often co-elute close to the main peak. Partial acylation is the realistic failure mode for this specific molecule, so the earlier-eluting shoulder is the peak worth integrating rather than ignoring.
Disulfide connectivity is not confirmed by mass alone and requires peptide mapping. Because the bridge is local, spanning only Cys2 to Cys7, an enzymatic digest under non-reducing conditions followed by LC-MS should show the intact bridged fragment, and a parallel reduced digest gives the assignment by mass shift. For work where aggregation state matters, thioflavin T fluorescence is the standard assay for beta-sheet amyloid content, and it is the assay the development paper's fibrillation work rests on; size exclusion chromatography gives the complementary readout of soluble oligomer content.
Cagrilintide FAQ
Cagrilintide Research Summary
Cagrilintide is the first amylin analogue engineered to survive both problems that kept the class marginal: it resists the amyloid fibrillation that makes human amylin unformulatable, through the N14E and V17R salt bridge and the three rat-amylin prolines, and it resists rapid clearance, through a C20 diacid on Lys1 that gave a reported human half-life of 159 to 195 hours. The sixth substitution, Y37P, buys something else again, letting the peptide engage the bare calcitonin receptor as well as all three amylin receptor phenotypes.
The human dataset is unusually complete for a compound at this stage: dose-finding at 26 weeks, a three-arm mechanistic comparison at 32 weeks, and two 68 week phase 3a trials totalling more than 4600 participants, all published in major journals. It is also honest about its limits. Cagrilintide alone reached -11.5% at 68 weeks against -14.9% for semaglutide alone, the combination lost its non-inferiority comparison against tirzepatide in REDEFINE 4, and the cardiovascular outcomes trial has not reported.
For laboratory work the compound occupies a specific and useful position. It is the reference dual amylin and calcitonin receptor agonist, and the fact that structures of it bound to CTR, AMY1R, AMY2R and AMY3R are all in the public record at 2.2 to 3.0 A makes it a well-characterised comparator for any in vitro study of the selective amylin agonists. This 10mg vial is a lyophilised research chemical for in vitro and preclinical use only and is not for human or veterinary use.
Scientific References
Primary literature and public trial registries only. No supplier or retailer pages are cited.
- 1Development of Cagrilintide, a Long-Acting Amylin AnalogueKruse T, Hansen JL, Dahl K, Schäffer L, Sensfuss U, et al. · Journal of Medicinal Chemistry · 2021
- 2Structural and dynamic features of cagrilintide binding to calcitonin and amylin receptorsCao J, Belousoff MJ, Johnson RM, Keov P, Deganutti G, et al. · Nature Communications · 2025
- 3Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trialEnebo LB, Berthelsen KK, Kankam M, Lund MT, Rubino DM, et al. · The Lancet · 2021
- 4Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trialLau DCW, Erichsen L, Francisco AM, Satylganova A, le Roux CW, et al. · The Lancet · 2021
- 5Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly semaglutide 2.4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trialFrias JP, Deenadayalan S, Erichsen L, Knop FK, Lingvay I, et al. · The Lancet · 2023
- 6Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity (REDEFINE 1)Garvey WT, Blüher M, Osorto Contreras CK, Davies MJ, Wilding JPH, et al. · New England Journal of Medicine · 2025
- 7Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes (REDEFINE 2)Davies MJ, Bajaj HS, Broholm C, Eliasen A, Garvey WT, et al. · New England Journal of Medicine · 2025
- 8Amylin: Pharmacology, Physiology, and Clinical PotentialHay DL, Chen S, Lutz TA, Parkes DG, Roth JD · Pharmacological Reviews · 2015
- 9Cagrilintide is not associated with clinically relevant QTc prolongation: A thorough QT study in healthy participantsGabe MBN, Fuhr R, Sinn A, Eliasen A, Berthelsen KK, et al. · Diabetes, Obesity and Metabolism · 2024
- 10NN1213: A Potent, Long-Acting, and Selective Analog of Human AmylinDahl K, Raun K, Hansen JL, Poulsen C, Dornonville de la Cour C, et al. · Journal of Medicinal Chemistry · 2024
- 11Cagrilintide, PubChem Compound Summary CID 171397054PubChem, National Library of Medicine
- 12REDEFINE 1: A Research Study to See How Well CagriSema Helps People Living With Obesity Lose Weight (NCT05567796)ClinicalTrials.gov
Disclaimer
All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are furnished for in-vitro studies only. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease.
Cagrilintide 10mg: frequently asked questions
Answered from the product record and the certificate file. Volta does not answer questions about administration, dosing or protocols.
What is supplied in a 10 mg vial of Cagrilintide?
A sealed single-use vial containing 10 mg of Cagrilintide as a lyophilized powder. Soluble in bacteriostatic water. No diluent, syringe or other supply is included.
Is Cagrilintide supplied for human use?
No. For in-vitro laboratory research by qualified professionals only. Not for human or animal administration. Not a drug, food, cosmetic or dietary supplement. Not intended to diagnose, treat, cure, mitigate or prevent any disease. Volta does not provide dosing, administration or protocol guidance for any material listed.
What purity is this Cagrilintide released to?
>99% by HPLC. That figure is a release specification, a threshold Volta sets for every batch, and it is not the same kind of statement as a purity measured by a named laboratory for a named lot.
Is there a certificate of analysis for this Cagrilintide vial?
A batch-specific Certificate of Analysis is available for this product on request. It is not published on the site yet: the batch history on the quality page lists the certificates already published, and this vial is covered by the release specification until its own is added there.
How is Cagrilintide identified?
CAS 1415456-99-3, molecular formula C₁₉₄H₃₁₂N₅₄O₅₉S₂, molecular weight 4,409.08 g/mol. Those identifiers are what an incoming-goods check compares a certificate against, and they are stated here so the comparison can be made before ordering.
How should Cagrilintide be stored before reconstitution?
Store lyophilized peptide at -20°C in a dry, dark environment. Reconstitute in bacteriostatic water. Once reconstituted, store at 2-8°C and use within 30 days. Avoid repeated freeze-thaw cycles. Lyophilized powder is stable at room temperature for shipping and short-term storage.
Does Volta list other vial sizes of Cagrilintide?
Yes: 5 mg. Each size is a separate listing with its own price, batch number and certificate status.
Where does this ship from?
British Columbia, Canada. Canadian orders are domestic, so they clear no customs and pay no import duty. International orders ship from the same facility.
Related Research News
Cagrilintide Research: What Is Cagrilintide and How Does It Work?
Research review of Cagrilintide, a dual amylin and calcitonin receptor agonist, covering mechanism, preclinical data, and safety.
Cagrilintide-Semaglutide May Aid Type 2 Diabetes Glycemic Control
A combination of cagrilintide and semaglutide could improve glycemic control in patients with type 2 diabetes who are already using basal insulin, according to a report from Docwire News. The finding suggests a potential new treatment option for managing blood sugar levels in this patient population.
Semaglutide Conference Presentation Leads ObesityWeek 2026 Preview
ObesityWeek 2026 is set for November 1-5, with semaglutide, tirzepatide, and a pipeline of next-generation compounds including retatrutide, survodutide, and cagrilintide on the agenda. A separate peptide therapeutics conference runs September 21-23, covering stapled peptides, cyclic peptides, and cell-penetrating peptides. Here is what researchers should watch for.
Explore Research
Peptide Tools
Cagrilintide research
Cagrilintide is a long-acting synthetic amylin analogue studied both alone and in fixed combination with semaglutide, and in phase 3 at the time of writing. Everything Volta publishes on this compound, across every vial size, is collected on Cagrilintide research hub.
Vial sizes of this compound
- Cagrilintide 5mg
- 10mg(this page)
Research on Cagrilintide
Handling and documentation
Cagrilintide is one of the compounds in Volta's weight management research peptides catalogue, which collects the rest of the range studied in this area alongside the comparisons and guides that cover it.
More from the research catalogue
Every compound below has its own specification, batch number and certificate page, whether or not a vial is in stock today. Supplied for laboratory research use only.
Other vial sizes
Related research compounds
- Eloralintide 10mgrestocking
- HGH Fragment 176-191 5mgrestocking
- L-Carnitine 5000mgrestocking
- Ipamorelin 5mg









