Cagrilintide: Research, Handling and Batch Documentation

Identity and research status

Also referred to as

AM833, NN9838

Sequence

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (37 residues, C-terminal amide)

Substitutions vs Human Amylin

N14E, V17R, A25P, S28P, S29P, Y37P

Lipidation

C20 alpha,omega-diacid (icosanedioic acid) coupled through a gamma-glutamyl spacer to the alpha-amino group of Lys1

Disulfide Bond

Cys2 to Cys7 (written as the 3 to 8 bridge in CAS nomenclature, which counts the gamma-Glu spacer as the first residue)

Molecular Formula

C194H312N54O59S2

Molecular Weight

4409.01 g/mol average (free acid); 4406.25 Da monoisotopic

CAS Number

1415456-99-3

PubChem CID

171397054

UNII

AO43BIF1U8

Development Codes

AM833, NNC0174-0833

Receptor Targets

AMY1R (CTR + RAMP1), AMY2R (CTR + RAMP2), AMY3R (CTR + RAMP3) and CTR alone

Reported Plasma Half-life

159 to 195 hours across the 0.16 mg to 4.5 mg range in the phase 1b trial

Des-acyl Backbone Mass

C169H269N53O53S2, about 3955.4 g/mol; the gamma-Glu plus C20 diacid arm accounts for the remaining 453.6 Da

Salt Form

Commonly supplied as the acetate salt (PubChem CID 164618153); the counterion adds mass without altering the peptide

Physical Form

Lyophilised white powder, research use only

Mechanism, in brief

Amylin receptors are not standalone proteins. They are heterodimers of the class B1 G protein-coupled calcitonin receptor (CTR) with one of three receptor activity-modifying proteins: CTR plus RAMP1 gives AMY1R, CTR plus RAMP2 gives AMY2R, and CTR plus RAMP3 gives AMY3R. CTR also reaches the cell surface without any RAMP, where it responds potently to calcitonin peptides and only weakly to amylin. Cagrilintide is an agonist at all four, and the 2025 cryo-electron microscopy work from Cao and colleagues resolved Gs-coupled complexes of cagrilintide with each one at 2.2 A for CTR, 2.2 A for AMY1R, 2.7 A for AMY2R and 3.0 A for AMY3R.

1. Albumin binding. The C20 alpha,omega-diacid on Lys1 binds serum albumin reversibly, which is what turns a peptide that would clear in minutes into one with a reported plasma half-life of 159 to 195 hours in the phase 1b trial.
2. Receptor engagement. Cagrilintide binds the shared C-terminal groove of the calcitonin receptor extracellular domain, with Pro37 buried against Trp79 rather than reaching for a RAMP. This gives measurable activity at AMY1R, AMY2R, AMY3R and CTR alone.
3. Gs coupling and cAMP. All four resolved complexes are Gs-coupled. Agonism is read out as cAMP accumulation, and the non-lipidated backbone shows that the lipid arm alters extracellular loop conformation in a way that matters for CTR but not for CTR plus RAMP3.
4. Hindbrain satiation signalling. Amylin receptors are dense in the area postrema, a circumventricular organ outside the blood-brain barrier. Hay and colleagues review the rodent and human evidence that amylin acting there ends a meal and interacts functionally with cholecystokinin, leptin and estradiol signalling.
5. Delayed gastric emptying and glucagon suppression. The classical peripheral amylin actions catalogued in the pharmacology literature: slowed gastric emptying and suppression of postprandial glucagon, both of which contribute to the glucose effects seen with amylin analogues.

The full research write-up, including the findings behind each claim and the model each came from, is on the Cagrilintide 5mg 5mg page.

Vial sizes available

Every size of Cagrilintide Volta lists, in stock or not. Each is a separate catalogue page with its own batch number and specification table.

• Cagrilintide 5mg 5mgBatch #: VPCG5100
  In stock
• Cagrilintide 10mg 10mgBatch #: VPCG10100
  Restocking

Purity and batch documentation

Volta's release specification is >99% (HPLC). That is a threshold we set. >99% is the specification every batch is released to. The figure on a certificate is what a laboratory measured for one lot.

No third-party certificate has been published for Cagrilintideyet. The certificates Volta does publish, with the laboratory's own verification link on each, are in the certificate archive.

Research on Cagrilintide

Handling and stability

Regulatory context

United States

Not yet FDA-approved. NDA filed by Novo Nordisk in 2026 for CagriSema (cagrilintide + semaglutide) for chronic weight management. FDA review expected 2026-2027.

European Union

Not approved. Regulatory filing anticipated.

• the legal status of research peptides in Canada
• Health Canada's regulatory position

Primary sources

1. Kruse T, Hansen JL, Dahl K, Schäffer L, Sensfuss U, et al.. Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry (2021). doi:10.1021/acs.jmedchem.1c00565
2. Cao J, Belousoff MJ, Johnson RM, Keov P, Deganutti G, et al.. Structural and dynamic features of cagrilintide binding to calcitonin and amylin receptors. Nature Communications (2025). doi:10.1038/s41467-025-58680-y
3. Enebo LB, Berthelsen KK, Kankam M, Lund MT, Rubino DM, et al.. Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet (2021). doi:10.1016/S0140-6736(21)00845-X
4. Lau DCW, Erichsen L, Francisco AM, Satylganova A, le Roux CW, et al.. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet (2021). doi:10.1016/S0140-6736(21)01751-7
5. Frias JP, Deenadayalan S, Erichsen L, Knop FK, Lingvay I, et al.. Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly semaglutide 2.4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. The Lancet (2023). doi:10.1016/S0140-6736(23)01163-7
6. Garvey WT, Blüher M, Osorto Contreras CK, Davies MJ, Wilding JPH, et al.. Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity (REDEFINE 1). New England Journal of Medicine (2025). doi:10.1056/NEJMoa2502081
7. Davies MJ, Bajaj HS, Broholm C, Eliasen A, Garvey WT, et al.. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes (REDEFINE 2). New England Journal of Medicine (2025). doi:10.1056/NEJMoa2502082
8. Hay DL, Chen S, Lutz TA, Parkes DG, Roth JD. Amylin: Pharmacology, Physiology, and Clinical Potential. Pharmacological Reviews (2015). doi:10.1124/pr.115.010629
9. Gabe MBN, Fuhr R, Sinn A, Eliasen A, Berthelsen KK, et al.. Cagrilintide is not associated with clinically relevant QTc prolongation: A thorough QT study in healthy participants. Diabetes, Obesity and Metabolism (2024). doi:10.1111/dom.15951
10. Dahl K, Raun K, Hansen JL, Poulsen C, Dornonville de la Cour C, et al.. NN1213: A Potent, Long-Acting, and Selective Analog of Human Amylin. Journal of Medicinal Chemistry (2024). doi:10.1021/acs.jmedchem.4c00022
11. Cagrilintide, PubChem Compound Summary CID 171397054. PubChem, National Library of Medicine
12. REDEFINE 1: A Research Study to See How Well CagriSema Helps People Living With Obesity Lose Weight (NCT05567796). ClinicalTrials.gov