Your cart is empty
Browse our catalog to add research compounds.
Calculate the molar extinction coefficient at 280 nm from an amino acid sequence using the Pace method, and convert absorbance readings to protein/peptide concentration via Beer-Lambert law.
Parsed sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
About this calculator
Extinction coefficients are estimated using the Pace method (Pace et al., 1995) based on the number of Trp, Tyr, and Cys (disulfide) residues. Actual values may differ due to protein folding, solvent effects, post-translational modifications, or non-standard amino acids. This tool is for educational and research reference only.