LL-37 vs KPV

LL-37 and KPV represent two distinct classes of research peptides with overlapping but mechanistically divergent applications. LL-37 is a 37-amino-acid human cathelicidin with broad antimicrobial and immunomodulatory properties, while KPV is a tripeptide derived from α-MSH that exerts anti-inflammatory effects via NF-κB suppression. LL-37 is primarily studied for wound healing and infection control, whereas KPV is investigated for gut inflammation and skin conditions. Their differences in size, origin, and mechanism underscore unique research niches, with LL-37 offering direct pathogen killing and KPV providing targeted anti-inflammatory action without melanocortin receptor activation.

LL-37 is the only human cathelicidin, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 exhibits immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial evaluated topical LL-37 in venous leg ulcers, providing clinical evidence for its wound-healing potential. Key research claims include broad-spectrum antimicrobial activity, promotion of wound healing, and immunomodulatory effects, supported by preclinical and early clinical studies.

KPV is a naturally occurring tripeptide (Lys-Pro-Val, MW ~342.4 g/mol) derived from the C-terminal region (positions 11–13) of alpha-melanocyte-stimulating hormone (α-MSH). It retains potent anti-inflammatory and antimicrobial properties of the full-length hormone without activating melanocortin receptors responsible for skin pigmentation or sexual arousal. KPV suppresses NF-κB activation and is transported into intestinal epithelial cells via the PepT1 transporter, which is upregulated during gut inflammation — creating a self-targeting mechanism. Its small size enables oral bioavailability, which is unusual for peptides. It was among the 12 peptides removed from FDA Category 2 on April 15, 2026.

Key claims: Reduces intestinal inflammation; Anti-inflammatory without pigmentation; Wound healing and skin benefits.

Both LL-37 and KPV are studied for immune support, though through distinct mechanisms. LL-37 is primarily researched for antimicrobial applications, including direct pathogen killing and biofilm disruption, as well as wound healing and angiogenesis. KPV is predominantly investigated for gut health, particularly in models of inflammatory bowel disease, due to its PepT1-mediated targeting of inflamed intestinal epithelium. While both peptides show anti-inflammatory properties, LL-37's immunomodulatory effects are broader, whereas KPV's are more focused on NF-κB suppression. Researchers should consider these differences when designing studies for specific disease models or therapeutic targets.

LL-37: No large-scale completed human safety trials exist for systemic therapeutic use. As an endogenous peptide, its levels are tightly regulated in healthy tissue. Injection site reactions, including redness, itching, and swelling, occur in approximately 5–10% of users due to mild inflammatory properties and local immune cell recruitment. KPV: No significant adverse effects have been reported in preclinical studies. It does not cause skin darkening, unlike Melanotan peptides, due to its lack of melanocortin receptor activation. No formal human safety trials have been conducted for KPV. Both peptides require further investigation to establish comprehensive safety profiles for clinical translation.