GHK-Cu vs LL-37

GHK-Cu and LL-37 are both naturally occurring peptides with research applications in wound healing and tissue repair, yet they operate through fundamentally different mechanisms. GHK-Cu, a copper-dependent tripeptide, is best known for its role in collagen synthesis and skin regeneration, with a robust safety profile from decades of cosmetic use. LL-37, a 37-amino-acid antimicrobial peptide, is central to innate immunity, offering broad-spectrum pathogen killing and immunomodulation. This comparison highlights their distinct mechanisms, evidence strengths, and research contexts to guide peptide selection for specific experimental models.

GHK-Cu (glycyl-L-histidyl-L-lysine) is a naturally occurring copper-binding tripeptide discovered by Dr. Loren Pickart in 1973. Plasma levels average 200 ng/mL at age 20, declining to ~80 ng/mL by age 60, suggesting a role in age-related tissue changes. Its mechanism involves copper-dependent activation of matrix metalloproteinases and upregulation of collagen, elastin, and proteoglycan synthesis, as demonstrated in preclinical models. Research indicates it modulates gene expression, reducing pro-inflammatory cytokines while promoting angiogenesis and wound closure. The evidence base includes decades of cosmetic use and clinical studies, particularly for skin firmness, elasticity, and fine line reduction. Molecular weight is ~340 g/mol (as the copper complex), with formula C14H24N6O4Cu. Studies suggest it enhances fibroblast activity and antioxidant defense, supporting its application in regenerative research.

LL-37 is the only human cathelicidin, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Its mechanism involves membrane disruption and immunomodulation, including chemotaxis of immune cells and modulation of cytokine release. Produced by epithelial and immune cells, its endogenous expression is vitamin D-dependent, linking it to innate immunity. A randomized controlled trial evaluated topical LL-37 in venous leg ulcers, showing accelerated healing. Research also suggests angiogenic properties via endothelial cell activation. However, the evidence base is less extensive than GHK-Cu, with no large-scale systemic safety trials. Its cationic nature and inflammatory potential require careful dosing in experimental models.

GHK-Cu and LL-37 converge in wound healing research but diverge in focus. GHK-Cu is primarily studied in skin health, anti-aging, and collagen-related models, such as dermal regeneration and scar reduction. LL-37 is investigated for immune support, antimicrobial defense, and infection-associated wound healing, particularly in chronic wounds or biofilm contexts. Both peptides have been used in preclinical models of tissue repair, but GHK-Cu's applications lean toward regenerative dermatology, while LL-37's extend to infectious disease and immunology. Researchers should select based on whether the experimental goal involves matrix remodeling (GHK-Cu) or pathogen clearance and immune modulation (LL-37).

GHK-Cu has an excellent safety profile from decades of cosmetic and clinical use (PMID: 29986520). Topical forms are generally well-tolerated, with mild skin irritation rare and typically limited to sensitive skin. Injectable forms may cause mild injection site reactions, lightheadedness, nausea, or flu-like symptoms; rotating injection sites reduces local irritation. LL-37 lacks large-scale systemic safety trials, though it is an endogenous peptide with tightly regulated levels in healthy tissue. Injection site reactions—redness, itching, swelling—occur in ~5-10% of users due to its mild inflammatory properties and local immune cell recruitment. Researchers should monitor for hypersensitivity, especially in immunomodulatory studies.