BPC-157 vs LL-37
Side-by-Side Comparison
| Attribute | Bpc 157 | Ll 37 |
|---|---|---|
| Category | Healing & Recovery | Antimicrobial / Immune |
| Mechanism | BPC-157 acts through multiple overlapping pathways. It promotes angiogenesis by upregulating VEGFR2 and VEGF expression, and activates nitric oxide synthesis via the Src kinase-caveolin-1 pathway and... | LL-37 (C120H232N42O38) carries a net positive charge (+6) that binds negatively charged bacterial membranes, creating transmembrane pores causing cell lysis. It also has anti-biofilm activity. |
| Evidence Rating | C — Phase I–II Clinical Trials | D — Preclinical |
| Clinical Status | Research-only / No approved human indication. Phase I oral safety trial completed; Phase II UC trial underway. | Investigational / Limited clinical trial data (topical wound healing RCT exists) |
| Safety Profile | No completed randomized controlled human clinical trials for safety assessment; Preclinical safety studies across multiple species found no toxic or lethal dose thresholds at ranges from 6 mcg/kg to 20 mg/kg; LD1 not achieved; no teratogenic, genotoxic, or anaphylactic effects in necropsy/histopathology | No large-scale completed human safety trials for systemic therapeutic use; Endogenous peptide -- naturally produced; levels are tightly regulated in healthy tissue |
| Route | Subcutaneous (preferred), Intramuscular, or Oral | Subcutaneous |
| Dose Range | 200–600 mcg/day SC; oral doses studied at 1–6 mg in clinical trials | 50–100 mcg/day SC |
| Frequency | Once daily | Once daily |
| Molecular Weight | ~1419.5 g/mol | ~4493.3 g/mol |
| Half-Life | ~15 min IV (animal data); oral activity persists 24+ hours | Minutes in plasma; tissue activity persists longer |
Overview
BPC-157 and LL-37 are both research peptides studied across multiple applications. This comparison examines their mechanisms, evidence base, dosing protocols, and safety profiles to help researchers understand the key differences and overlaps.
BPC-157 — Mechanism & Evidence
BPC-157 is a synthetic 15-amino-acid peptide (sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, MW ~1419.5 g/mol) derived from a protein found in human gastric juice. It has demonstrated robust regenerative and cytoprotective effects across hundreds of animal studies spanning tendon, ligament, muscle, bone, nerve, GI tract, and blood vessel healing. However, human clinical data is extremely limited — only three pilot studies have examined BPC-157 in humans as of 2025 (knee pain n=16, interstitial cystitis n=12, IV safety n=2). The FDA classifies it as Category 2, prohibiting compounding, and WADA bans its use in sports.
Key claims: Accelerates tendon and ligament healing; Heals gut lining and treats leaky gut; Reverses NSAID-induced GI damage.
LL-37 — Mechanism & Evidence
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 has immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial cells and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial has evaluated topical LL-37 in venous leg ulcers.
Key claims: Broad-spectrum antimicrobial activity; Promotes wound healing; Immunomodulatory effects.
Shared Research Applications
These peptides target different research areas. BPC-157 focuses on Injury Recovery, Gut Health, while LL-37 targets Immune Support, Antimicrobial.
Safety Considerations
BPC-157: No completed randomized controlled human clinical trials for safety assessment Preclinical safety studies across multiple species found no toxic or lethal dose thresholds at ranges from 6 mcg/kg to 20 mg/kg; LD1 not achieved; no teratogenic, genotoxic, or anaphylactic effects in necropsy/histopathology FDA previously classified BPC-157 as Category 2 (significant safety concerns); removed from Category 2 on April 15, 2026. PCAC review pending July 2026 to determine compounding eligibility. FDA noted insufficient human safety data and potential immunogenicity risks.
LL-37: No large-scale completed human safety trials for systemic therapeutic use Endogenous peptide -- naturally produced; levels are tightly regulated in healthy tissue Injection site reactions: redness, itching, swelling due to mild inflammatory properties and local immune cell recruitment (~5-10% of users)
Related Products
Related Research News
BPC-157 Gut Health: Gastric Cytoprotection Studies
Research on BPC-157 began with gastric cytoprotection in the early 1990s, led by Sikiric and colleagues at the University of Zagreb. Studies show it protects against ethanol-induced lesions and NSAID damage in rat models, with effects linked to angiogenesis, prostaglandins, nitric oxide, and gut-brain signaling. This body of work highlights its stability for oral use and broad preclinical applications in GI models.
BPC-157 Shelf Life: Lyophilized vs Reconstituted Stability Guide
BPC-157 has a finite shelf life that varies by form and storage. Lyophilized powder lasts 12-18 months refrigerated or 24+ months frozen, while reconstituted solution holds for about 28 days under refrigeration. Factors like temperature, light, and handling influence stability, and researchers should watch for signs of degradation to ensure reliable results.
BPC-157 + TB-500 Peptide Blend: Research on Healing and Repair
The BPC-157 and TB-500 peptide blend draws attention in research for potential synergy in tissue repair, angiogenesis, and reducing inflammation. BPC-157, a 15-amino-acid synthetic peptide, interacts with growth factors in preclinical models. TB-500, a 43-amino-acid analog of Thymosin Beta-4, supports cell migration and regeneration. Studies explore their roles in wound healing, tendon recovery, and more.