BPC-157 vs LL-37

BPC-157 and LL-37 are both research peptides studied across multiple applications. This comparison examines their mechanisms, evidence base, dosing protocols, and safety profiles to help researchers understand the key differences and overlaps.

BPC-157 is a synthetic 15-amino-acid peptide (sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, MW ~1419.5 g/mol) derived from a protein found in human gastric juice. It has demonstrated robust regenerative and cytoprotective effects across hundreds of animal studies spanning tendon, ligament, muscle, bone, nerve, GI tract, and blood vessel healing. However, human clinical data is extremely limited — only three pilot studies have examined BPC-157 in humans as of 2025 (knee pain n=16, interstitial cystitis n=12, IV safety n=2). The FDA classifies it as Category 2, prohibiting compounding, and WADA bans its use in sports.

Key claims: Accelerates tendon and ligament healing; Heals gut lining and treats leaky gut; Reverses NSAID-induced GI damage.

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 has immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial cells and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial has evaluated topical LL-37 in venous leg ulcers.

Key claims: Broad-spectrum antimicrobial activity; Promotes wound healing; Immunomodulatory effects.

These peptides target different research areas. BPC-157 focuses on Injury Recovery, Gut Health, while LL-37 targets Immune Support, Antimicrobial.

BPC-157: No completed randomized controlled human clinical trials for safety assessment Preclinical safety studies across multiple species found no toxic or lethal dose thresholds at ranges from 6 mcg/kg to 20 mg/kg; LD1 not achieved; no teratogenic, genotoxic, or anaphylactic effects in necropsy/histopathology FDA previously classified BPC-157 as Category 2 (significant safety concerns); removed from Category 2 on April 15, 2026. PCAC review pending July 2026 to determine compounding eligibility. FDA noted insufficient human safety data and potential immunogenicity risks.

LL-37: No large-scale completed human safety trials for systemic therapeutic use Endogenous peptide -- naturally produced; levels are tightly regulated in healthy tissue Injection site reactions: redness, itching, swelling due to mild inflammatory properties and local immune cell recruitment (~5-10% of users)