Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|
All Guides

Immune & Thymic Peptides

Thymic peptides, immunomodulators, and antimicrobial peptides

Overview

Immune and thymic peptides encompass a diverse class of compounds that modulate innate and adaptive immune function through distinct but complementary mechanisms. Thymic peptides — derived from or inspired by thymus gland secretions — support T-cell maturation, differentiation, and immune surveillance. Antimicrobial peptides (AMPs) like LL-37 provide direct pathogen defense while also orchestrating immune cell recruitment and tissue repair. This class includes thymosin alpha-1, which is approved in over 35 countries for hepatitis B and as an immune adjuvant, making it one of the most clinically validated peptides outside the GLP-1 class. Research in this area spans infectious disease, oncology immunotherapy, wound healing, and autoimmune modulation.

Thymic Peptide Biology

The thymus gland is the central organ of T-cell immunity. Located in the anterior mediastinum, it is most active during childhood and progressively involutes (shrinks and is replaced by fatty tissue) after puberty — a process called thymic involution. This involution is directly correlated with age-related immune decline (immunosenescence), characterized by reduced naive T-cell output, contracted T-cell receptor diversity, impaired vaccine responses, and increased susceptibility to infections and cancer.

Thymic peptides are naturally produced by thymic epithelial cells to guide thymocyte development. Thymosin alpha-1 (Ta1) is a 28-amino acid peptide that promotes T-cell maturation from pre-T cells, enhances dendritic cell function and antigen presentation, activates natural killer (NK) cells, and modulates the Th1/Th2 balance toward Th1-mediated cellular immunity. It acts through Toll-like receptor 2 (TLR2) and TLR9 signaling on dendritic cells, triggering MyD88-dependent pathways that upregulate MHC class I expression and drive pro-inflammatory cytokine production (IL-12, IFN-alpha).

Thymulin (formerly called Facteur Thymique Serique or FTS) is a zinc-dependent nonapeptide (nine amino acids) secreted by thymic epithelial cells. It requires zinc binding for biological activity and promotes T-cell differentiation, modulates cytokine release, and has demonstrated anti-inflammatory effects in neuroinflammation models. Serum thymulin levels decline sharply with age, paralleling thymic involution, and zinc deficiency further reduces its activity — creating a link between nutritional status and immune function.

Thymalin is a mixture of polypeptide fractions extracted from calf thymus, developed by Vladimir Khavinson as part of his bioregulatory peptide research program. It has been used clinically in Russia since the 1980s for immunodeficiency states, though Western clinical data is minimal. Thymogen, a synthetic dipeptide (glutamyl-tryptophan), is a related Khavinson bioregulator with immunomodulatory activity attributed to thymic peptide mimicry.

Key Peptides in This Class

Thymosin Alpha-1 (Ta1) — the most clinically validated immune peptide globally. Marketed as Zadaxin, it is approved in over 35 countries (not including the US) for chronic hepatitis B, as a vaccine adjuvant in immunocompromised patients, and as an adjunctive immunotherapy in hepatocellular carcinoma. Ta1 enhances both innate and adaptive immunity: it activates dendritic cells via TLR2/TLR9, promotes CD4+ and CD8+ T-cell maturation, increases NK cell cytotoxicity, and shifts immune responses toward Th1 dominance. Its 28-amino acid structure gives it a half-life of approximately 2 hours, with standard dosing of 1.6 mg subcutaneous injection twice weekly. During the COVID-19 pandemic, Ta1 was used as an adjunctive treatment in several countries, with retrospective studies suggesting reduced mortality in critically ill patients with low lymphocyte counts.

Thymulin (FTS-Zn) — a zinc-metallopeptide with immunomodulatory and anti-inflammatory properties. Research has focused on its neuroprotective effects in demyelinating disease models, its role in T-cell differentiation, and its potential as an anti-inflammatory agent. Intranasal thymulin delivery has been studied in animal models of central nervous system inflammation, showing reduced demyelination and improved neurological outcomes. Its requirement for zinc binding makes it unique among immune peptides and connects immune function to trace mineral nutrition.

LL-37 — the only cathelicidin-derived antimicrobial peptide in humans. This 37-amino acid peptide is produced by neutrophils, macrophages, and epithelial cells as part of the innate immune response. LL-37 has direct antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, fungi, and enveloped viruses by disrupting microbial membranes through electrostatic interactions. Beyond direct killing, LL-37 modulates immune responses by recruiting neutrophils and monocytes through formyl peptide receptor-like 1 (FPRL1) activation, promoting angiogenesis and wound healing, neutralizing lipopolysaccharide (LPS) to reduce endotoxin-driven inflammation, and enhancing macrophage phagocytosis. Clinical research has explored LL-37 for chronic wound healing, with a phase I/II trial in venous leg ulcers showing improved healing rates with topical application.

Defensins — a broad family of small (29-45 amino acid) cationic antimicrobial peptides produced by neutrophils (alpha-defensins) and epithelial cells (beta-defensins). They form a key component of mucosal innate immunity in the respiratory tract, GI tract, and skin. While not typically used as exogenous peptide therapeutics, defensin research informs the development of novel antimicrobial and immunomodulatory agents.

BPC-157 and TB-500 — while primarily classified as healing/recovery peptides, both have significant immunomodulatory properties. BPC-157 modulates the inflammatory cascade through NF-kB pathway effects, and TB-500 (thymosin beta-4) — despite its name suggesting thymic origin — primarily acts through actin sequestration but also influences immune cell migration and inflammatory resolution. They are included in this class for completeness but are covered in greater detail in the Healing & Recovery hub.

In Stock

KLOW 80mg

Batch purity 99.74%· averageBPC-157 99.59%TB-500 99.62%GHK-Cu 99.81%KPV 99.64%
$84 USD
In Stock

KPV 10mg

Batch purity 99.7%
$39 USD
In Stock

HCG 5,000iu

$44 USD

Evidence Landscape

Thymosin alpha-1 has the most extensive clinical evidence base in this class, with over 4,400 published papers and more than 80 clinical trials across multiple indications. For chronic hepatitis B, randomized controlled trials demonstrated sustained virological response rates of 25-35% with Ta1 monotherapy (comparable to interferon-alpha) and significantly improved response rates when combined with interferon or nucleoside analogues. In hepatocellular carcinoma, adjuvant Ta1 combined with transcatheter arterial chemoembolization (TACE) improved overall survival in multiple trials. As a vaccine adjuvant, Ta1 enhanced seroconversion rates for influenza and hepatitis B vaccines in elderly and immunocompromised populations — groups that typically show poor vaccine responses. During COVID-19, retrospective studies from China and Italy reported that Ta1 administration was associated with reduced 28-day mortality in critically ill patients with lymphocytopenia (lymphocyte count < 0.5 x 10^9/L), though no prospective RCTs were completed.

LL-37 clinical evidence is earlier-stage but promising. A phase I/II randomized trial (Gronberg et al., 2014) of topical LL-37 in venous leg ulcers showed a significantly higher healing rate at the optimal dose (0.5 mg/mL) compared to placebo, with a favorable safety profile. Preclinical studies have demonstrated efficacy against biofilm-forming bacteria, including methicillin-resistant Staphylococcus aureus (MRSA), and in infected wound models. LL-37 analogues and derivatives are in development to improve stability, reduce cost, and optimize the therapeutic index between antimicrobial potency and host cell toxicity.

Thymulin has primarily preclinical evidence. Animal studies in experimental autoimmune encephalomyelitis (EAE) — a model for multiple sclerosis — showed that intranasal thymulin-zinc reduced demyelination and improved functional outcomes. Its role in T-cell differentiation is well-established in vitro. Human clinical data is limited to older observational studies from the 1980s-1990s.

Thymalin and Thymogen have clinical usage data from Russian medical practice spanning several decades but minimal Western peer-reviewed evidence. Their efficacy claims are based on Russian-language publications and clinical registries, making independent verification challenging.

Safety Considerations

Thymosin alpha-1 has an excellent safety profile established across thousands of patients in clinical trials and post-marketing surveillance. The most commonly reported adverse effects are mild injection site reactions (pain, erythema) occurring in approximately 5-10% of patients. Systemic side effects are rare. Because Ta1 modulates rather than suppresses immunity, it does not carry the infection risk associated with immunosuppressive therapies. However, its Th1-promoting effects mean it should be used with caution in patients with autoimmune conditions driven by Th1 hyperactivation (e.g., certain forms of thyroiditis, type 1 diabetes) — though clinical evidence of autoimmune exacerbation is limited. Ta1 is not FDA-approved in the United States, and its regulatory status varies by country.

LL-37 safety considerations center on the balance between antimicrobial activity and potential host cell cytotoxicity at higher concentrations. In clinical studies, topical LL-37 was well-tolerated with no serious adverse events. However, endogenous LL-37 dysregulation is implicated in certain inflammatory conditions — overexpression is associated with psoriasis and rosacea pathogenesis, while deficiency is linked to increased infection susceptibility. Exogenous LL-37 administration does not appear to trigger these pathological states at therapeutic doses, but long-term safety data is limited.

Thymulin requires adequate zinc status for biological activity. In zinc-deficient individuals, thymulin administration may have reduced efficacy. Conversely, ensuring zinc sufficiency (through supplementation if needed) may potentiate thymulin activity. This zinc dependency should be considered when interpreting research results and designing protocols.

General safety principles for immune-modulating peptides include: avoidance in patients with active autoimmune disease unless specifically indicated; caution in organ transplant recipients on immunosuppressive regimens (immune activation could theoretically promote rejection); monitoring for hypersensitivity reactions, particularly with animal-derived preparations like thymalin; and awareness that immune stimulation in the context of active malignancy has both potential benefits (enhanced immune surveillance) and theoretical risks (inflammation-driven tumor progression in certain contexts). All immune peptides should be used under medical supervision, with appropriate baseline and follow-up immunological monitoring (lymphocyte subsets, immunoglobulin levels, inflammatory markers).

Key Peptides

Thymosin Alpha-1

C

Thymosin alpha-1 (Ta1) is a clinically proven, 28-amino-acid peptide (MW ~3,108 g/mol, Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-...

Immune ModulatorShop Thymosin Alpha-1

Thymulin

C

Thymulin (FTS) is a 9-amino-acid zinc metallopeptide (sequence: pyroGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn, MW ~858 g/mol) secreted exclusively by thymic...

Immune Modulator

LL-37

D

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with br...

Antimicrobial / ImmuneShop LL-37

Thymalin

C

Thymalin is a polypeptide complex isolated from calf thymus glands, developed by Vladimir Khavinson and colleagues at the St. Petersburg Institute of ...

Immune / Anti-AgingShop Thymalin

BPC-157

C

BPC-157 is a synthetic 15-amino-acid peptide (sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, MW ~1419.5 g/mol) derived from a ...

Healing & Recovery Research PeptidesShop BPC-157

TB-500

D

TB-500 is a synthetic fragment of thymosin beta-4 (Tβ4), a naturally occurring 43-amino-acid peptide found throughout human tissues. TB-500 contains t...

Healing & Recovery Research PeptidesShop TB-500

Related Tools

Shop Research Peptides

In Stock

KLOW 80mg

Batch purity 99.74%· averageBPC-157 99.59%TB-500 99.62%GHK-Cu 99.81%KPV 99.64%
$84 USD
In Stock

KPV 10mg

Batch purity 99.7%
$39 USD
In Stock

HCG 5,000iu

$44 USD
In Stock

MOTS-C 10mg

Batch purity 99.4%
$32 USD
In Stock

Epithalon 10mg

$34 USD
In Stock

DSIP 10mg

$46.71 USD
In Stock

BPC-157 5mg

5mg

Batch purity 99.9%· 10mg lot
$35 USD
In Stock

5-Amino-1MQ 10mg

Batch purity 99.7%
$43 USD
In Stock

BPC-157 10mg

10mg

Batch purity 99.9%
$46 USD

Browse the research catalogue

Buying and verification

Research Disclaimer: The information on this page is for educational purposes only and does not constitute medical advice. All products referenced are for in vitro laboratory research use only. Consult a qualified healthcare professional before beginning any research protocol.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.