Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|Canadian Based Peptide Supplier|Ships from British Columbia, Canada|International Shipping Available|HPLC-Tested Batches|>99% Purity Specification|Same Day Shipping|Batch-Specific COAs|
All Guides

Healing & Recovery Peptides

Tissue repair, angiogenesis, and the science of regenerative peptides

Overview

Healing and recovery peptides represent one of the most popular research areas in peptide science. These compounds promote tissue repair through mechanisms including angiogenesis (new blood vessel formation), cell migration, collagen synthesis, anti-inflammatory signaling, and growth factor modulation. While preclinical evidence is extensive, human clinical data remains limited for most compounds in this class.

Mechanisms of Tissue Repair

Regenerative peptides operate through multiple complementary pathways. BPC-157 promotes angiogenesis via VEGFR2 upregulation and activates the nitric oxide system through the Src kinase-caveolin-1 pathway. TB-500 (thymosin beta-4) acts through actin sequestration to promote cell migration and differentiation. Together, these mechanisms support wound healing, tendon/ligament repair, and mucosal regeneration. The inflammatory cascade is modulated through NF-kB inhibition, M1-to-M2 macrophage polarization, and cytokine regulation.

Key Peptides in This Class

BPC-157 — a 15-amino acid synthetic peptide derived from human gastric juice with extensive preclinical evidence across tendon, ligament, muscle, bone, nerve, and GI healing. TB-500 (Thymosin Beta-4) — a 43-amino acid peptide that promotes systemic tissue repair through actin regulation and cell migration. TB4-FRAG (TB-500 Fragment 17-23) — the active fragment of thymosin beta-4, smaller and potentially more targeted. The BPC-157 + TB-500 combination (the "Wolverine Stack") is the most popular healing protocol in the peptide community, combining localized repair with systemic anti-inflammatory effects.

In Stock

BPC-157 5mg

5mg

Batch purity 99.9%· 10mg lot
$35 USD
In Stock

BPC-157 10mg

10mg

Batch purity 99.9%
$46 USD
In Stock

TB-500 10mg

10mg

Batch purity 99.5%
$69 USD

The Wolverine Stack

Named for its regenerative properties, the Wolverine Stack combines BPC-157 (250-500mcg daily, subcutaneous near injury site) with TB-500 (2-4mg loading dose twice weekly, then 1-2mg maintenance). The rationale is complementary mechanisms: BPC-157 for localized angiogenesis and tissue-specific repair, TB-500 for systemic cell migration and inflammation reduction. Typical protocols run 8-12 weeks. Initial improvements in pain and inflammation are commonly reported within 1-2 weeks, with significant tissue repair at 4-6 weeks.

Evidence & Regulatory Status

BPC-157 has hundreds of preclinical studies but only three small human pilot studies (knee pain n=16, interstitial cystitis n=12, IV safety n=2). It was removed from FDA Category 2 in April 2026 and is under PCAC review for compounding eligibility. TB-500 has wound healing data from animal models. Both are WADA-prohibited substances. The theoretical concern of pathologic angiogenesis (potentially supporting tumor growth) means these peptides are contraindicated in individuals with active cancer or cancer history.

Key Peptides

BPC-157

C

BPC-157 is a synthetic 15-amino-acid peptide (sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, MW ~1419.5 g/mol) derived from a ...

Healing & Recovery Research PeptidesShop BPC-157

TB-500

D

TB-500 is a synthetic fragment of thymosin beta-4 (Tβ4), a naturally occurring 43-amino-acid peptide found throughout human tissues. TB-500 contains t...

Healing & Recovery Research PeptidesShop TB-500

TB-500 Fragment 17-23

D

TB-500 Fragment 17-23 (sequence: LKKTETQ) represents the minimal actin-binding domain of Thymosin Beta-4. This 7-amino-acid fragment retains the abili...

Healing / Research

BPC-157 + TB-500

D

A popular combination blend of two leading tissue repair peptides, BPC-157 and TB-500, often used together in research for synergistic healing effects...

Healing & Recovery Research Peptides

GHK-Cu

F

GHK-Cu is a naturally occurring copper-binding tripeptide (glycyl-L-histidyl-L-lysine) found in human plasma, saliva, and urine. First discovered by D...

Skin & Tissue RepairShop GHK-Cu

GHK

C

GHK is a naturally occurring tripeptide (Gly-His-Lys) that serves as the base form of GHK-Cu. Found in human plasma, saliva, and urine, its concentrat...

Skin & CosmeticShop GHK

LL-37

D

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with br...

Antimicrobial / ImmuneShop LL-37

Thymosin Beta-4

B

Thymosin beta-4 (Tβ4) is a naturally occurring 43-amino acid protein found in virtually all human and animal cells. It is the most abundant member of ...

Healing & Recovery Research Peptides

IGF-1

A

Insulin-like Growth Factor 1 (IGF-1) is a 70-amino acid protein structurally similar to insulin. It is primarily produced by the liver in response to ...

Growth FactorShop IGF-1

MGF

D

MGF (Mechano Growth Factor) is a splice variant of IGF-1, specifically the E-domain peptide of the IGF-1Ec isoform. It is produced naturally in mechan...

Growth FactorShop MGF

PEG-MGF

D

PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic, PEGylated form of the C-terminal peptide of mechano growth factor (MGF), a splice variant of...

Muscle & PerformanceShop PEG-MGF

Follistatin

C

Follistatin is a naturally occurring glycoprotein researched for its ability to inhibit myostatin and activin, potentially promoting significant muscl...

Growth & Performance

Related Tools

Shop Research Peptides

In Stock

BPC-157 5mg

5mg

Batch purity 99.9%· 10mg lot
$35 USD
In Stock

BPC-157 10mg

10mg

Batch purity 99.9%
$46 USD
In Stock

TB-500 10mg

10mg

Batch purity 99.5%
$69 USD
In Stock

SS-31 10mg

10mg

Batch purity 99.6%
$49 USD
In Stock

5-Amino-1MQ 10mg

Batch purity 99.7%
$43 USD
In Stock

Cagrilintide 5mg

$57 USD
In Stock

DSIP 10mg

$46.71 USD
In Stock

Epithalon 10mg

$34 USD
In Stock

GHK-Cu 100mg

Batch purity 99.8%
$59 USD

Browse the research catalogue

Buying and verification

Research Disclaimer: The information on this page is for educational purposes only and does not constitute medical advice. All products referenced are for in vitro laboratory research use only. Consult a qualified healthcare professional before beginning any research protocol.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.