Ships from British Columbia, Canada|No Customs, No Border Delays|Lab Verified|≥98% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|No Customs, No Border Delays|Lab Verified|≥98% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|No Customs, No Border Delays|Lab Verified|≥98% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|Ships from British Columbia, Canada|No Customs, No Border Delays|Lab Verified|≥98% Purity Guarantee|Shipped Within 24hr|Batch-Specific COAs|
Coming soon

LL-37 in Canada

Antimicrobial / Immune

Also known as Cathelicidin, hCAP-18, CAMP.

LL-37 is not in the catalogue yet. When it ships it will be dispatched from British Columbia, so Canadian orders clear no customs and cross no border. Add your email below and you will hear the day it is available.

Notify me when LL-37 is available

One email when it launches. Nothing else.

Get Notified When Available

This product is currently out of stock. Enter your email and we'll notify you the moment it's back.

About LL-37

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 has immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial cells and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial has evaluated topical LL-37 in venous leg ulcers.

Mechanism

LL-37 (C120H232N42O38) carries a net positive charge (+6) that binds negatively charged bacterial membranes, creating transmembrane pores causing cell lysis. It also has anti-biofilm activity. Immunomodulatory functions include both pro- and anti-inflammatory responses: it neutralizes endotoxins (LPS), recruits immune cells via chemotaxis, and triggers inflammasome signaling (P2X7 receptor). It interacts with host receptors FPRL-1, P2X7, and EGFR, boosting cell proliferation, angiogenesis, and immunoregulation. Topical LL-37 enhances keratinocyte and endothelial cell migration, re-epithelialization, and neovascularization.

In the meantime

Volta Peptides supplies materials strictly for in-vitro laboratory research. Nothing on this page is a drug, supplement, cosmetic or food, and nothing here is intended for human or animal use, clinical application or diagnostic procedures. The research summary above describes published literature and is not a claim of therapeutic benefit or a statement that this compound is offered for such use.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.